Ligand
Structure
Job ID
9069676bc0da30cae69182dac941f7de
Job name
NA
Time
2026-02-27 11:56:18
| Rank | Target | PDB ID |
AirScore |
Detail |
|---|---|---|---|---|
| 81 | Pyruvate dehydrogenase [ubiquinone] | 3EYA | 3.93 | |
Target general information Gen name poxB Organism Escherichia coli (strain K12) Uniprot ID TTD ID NA Synonyms b0871;JW0855 Protein family TPP enzyme family Biochemical class Oxidoreductase Function Flavin adenine dinucleotide binding.Identical protein binding.Lipid binding.Magnesium ion binding.Pyruvate dehydrogenase (quinone) activity.Thiamine pyrophosphate binding. Related diseases Glycogen storage disease 6 (GSD6) [MIM:232700]: A metabolic disorder characterized by mild to moderate hypoglycemia, mild ketosis, growth retardation, and prominent hepatomegaly. Heart and skeletal muscle are not affected. {ECO:0000269|PubMed:9529348}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) NA Interacts with P07003 EC number 1.2.5.1 Uniprot keywords 3D-structure; Cell inner membrane; Cell membrane; Direct protein sequencing; FAD; Flavoprotein; Lipid-binding; Magnesium; Membrane; Metal-binding; Nucleotide-binding; Oxidoreductase; Pyruvate; Reference proteome; Thiamine pyrophosphate; Ubiquinone Protein physicochemical properties Chain ID A,B,C,D,E,F,G,H,I,J,K,L Molecular weight (Da) 113027 Length 1046 Aromaticity 0.07 Instability index 35.99 Isoelectric point 5.75 Charge (pH=7) -24.38 3D Binding mode Sequence MKQTVAAYIAKTLESAGVKRIWGVTGDSLNGLSDSLNRMGTIEWMSTRHEEVAAFAAGAEAQLSGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQELFRECSHYCELVSSPEQIPQVLAIAMRKAVLNRGVSVVVLPGDVALKPAPEGATMHWYHAPQPVVTPEEEELRKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKIKAPIVHALRGKEHVEYDNPYDVGMTGLIGFSSGFHTMMNADTLVLLGTQFPYRAFYPTDAKIIQIDINPASIGAHSKVDMALVGDIKSTLRALLPLVEEKADRKFLDKALEDYRDARKGLDDLAKPSEKAIHPQYLAQQISHFAADDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAQATEPERQVVAMCGDGGFSMLMGDFLSVVQMKLPVKIVVFNNSVLGFDGTELHDTNFARIAEACGITGIRVEKASEVDEALQRAFSIDGPVLVDVVVAKEELAIPMKQTVAAYIAKTLESAGVKRIWGVTGDSLNGLSDSLNRMGTIEWMSTRHEEVAAFAAGAEAQLSGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQELFRECSHYCELVSSPEQIPQVLAIAMRKAVLNRGVSVVVLPGDVALKPAPEGATMHWYHAPQPVVTPEEEELRKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKIKAPIVHALRGKEHVEYDNPYDVGMTGLIGFSSGFHTMMNADTLVLLGTQFPYRAFYPTDAKIIQIDINPASIGAHSKVDMALVGDIKSTLRALLPLVEEKADRKFLDKALEDYRDARKGLDDLAKPSEKAIHPQYLAQQISHFAADDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAQATEPERQVVAMCGDGGFSMLMGDFLSVVQMKLPVKIVVFNNSVLGFVGTELHDTNFARIAEACGITGIRVEKASEVDEALQRAFSIDGPVLVDVVVAKEELAIP Hydrogen bonds contact Hydrophobic contact | ||||
| 82 | Arginase-1 | 2AEB | 3.93 | |
Target general information Gen name ARG1 Organism Homo sapiens (Human) Uniprot ID TTD ID NA Synonyms NA Protein family Arginase family Biochemical class Hydrolase / hydrolase inhibitor Function Arginase activity.Manganese ion binding. Related diseases Argininemia (ARGIN) [MIM:207800]: A rare autosomal recessive disorder of the urea cycle. Arginine is elevated in the blood and cerebrospinal fluid, and periodic hyperammonemia occurs. Clinical manifestations include developmental delay, seizures, intellectual disability, hypotonia, ataxia and progressive spastic quadriplegia. {ECO:0000269|PubMed:1463019, ECO:0000269|PubMed:22959135, ECO:0000269|PubMed:23859858, ECO:0000269|PubMed:7649538}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB01983; DB04585; DB04197; DB02499; DB06757; DB03144; DB02381; DB00129; DB04530; DB03731; DB04648; DB02689; DB03904 Interacts with NA EC number 3.5.3.1 Uniprot keywords 3D-structure; Adaptive immunity; Alternative splicing; Arginine metabolism; Cytoplasm; Disease variant; Hydrolase; Immunity; Innate immunity; Manganese; Metal-binding; Phosphoprotein; Proteomics identification; Reference proteome; Urea cycle Protein physicochemical properties Chain ID A,B Molecular weight (Da) 33278.8 Length 309 Aromaticity 0.06 Instability index 25.2 Isoelectric point 6.45 Charge (pH=7) -1.83 3D Binding mode Sequence SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHK Hydrogen bonds contact Hydrophobic contact | ||||
| 83 | Hydrogen peroxide-inducible genes activator | 1I69 | 3.93 | |
Target general information Gen name oxyR Organism Escherichia coli (strain K12) Uniprot ID TTD ID NA Synonyms b3961;mor;momR;JW3933 Protein family LysR transcriptional regulatory family Biochemical class Transcription Function Bacterial-type RNA polymerase core promoter proximal region sequence-specific DNA binding.Transcription factor activity, bacterial-type RNA polymerase core promoter proximal region sequence-specific binding. Related diseases Pigmentary disorder, reticulate, with systemic manifestations, X-linked (PDR) [MIM:301220]: An X-linked recessive disorder characterized by recurrent infections and sterile inflammation in various organs. Diffuse skin hyperpigmentation with a distinctive reticulate pattern is universally evident by early childhood. This is later followed in many patients by hypohidrosis, corneal inflammation and scarring, enterocolitis that resembles inflammatory bowel disease, and recurrent urethral strictures. Melanin and amyloid deposition is present in the dermis. Affected males also have a characteristic facies with frontally upswept hair and flared eyebrows. Female carriers have only restricted pigmentary changes along Blaschko's lines. {ECO:0000269|PubMed:27019227}. The disease is caused by variants affecting the gene represented in this entry. XLPDR is caused by a recurrent intronic mutation that results in missplicing and reduced POLA1 expression. This leads to a decrease in cytosolic RNA:DNA hybrids and constitutive activation of type I interferon responses, but has no effect on cell replication. {ECO:0000269|PubMed:27019227}.; DISEASE: Van Esch-O'Driscoll syndrome (VEODS) [MIM:301030]: An X-linked recessive syndrome characterized by different degrees of intellectual disability, moderate to severe short stature, microcephaly, hypogonadism, and variable congenital malformations. {ECO:0000269|PubMed:31006512}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) NA Interacts with NA EC number NA Uniprot keywords 3D-structure; Activator; Direct protein sequencing; Disulfide bond; DNA-binding; Glutathionylation; Oxidation; Reference proteome; Repressor; S-nitrosylation; Stress response; Transcription; Transcription regulation Protein physicochemical properties Chain ID A,B Molecular weight (Da) 46013 Length 412 Aromaticity 0.07 Instability index 44.76 Isoelectric point 5.57 Charge (pH=7) -14.52 3D Binding mode Sequence ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHSLRDQAMGFCFDTHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFDETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHSLRDQAMGFCFETHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFD Hydrogen bonds contact Hydrophobic contact | ||||
| 84 | Interferon gamma | 1FYH | 3.93 | |
Target general information Gen name IFNG Organism Homo sapiens (Human) Uniprot ID TTD ID NA Synonyms NA Protein family Type II (or gamma) interferon family Biochemical class Immune system Function Cytokine activity.Interferon-gamma receptor binding. Related diseases Aplastic anemia (AA) [MIM:609135]: A form of anemia in which the bone marrow fails to produce adequate numbers of peripheral blood elements. It is characterized by peripheral pancytopenia and marrow hypoplasia. {ECO:0000269|PubMed:15327519}. Disease susceptibility may be associated with variants affecting the gene represented in this entry.; DISEASE: Immunodeficiency 69 (IMD69) [MIM:618963]: A form of Mendelian susceptibility to mycobacterial disease, a rare condition caused by impairment of interferon-gamma mediated immunity. It is characterized by predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine, environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections. Clinical outcome severity depends on the degree of impairment of interferon-gamma mediated immunity. IMD69 is an autosomal recessive disorder manifesting with fever, hepatosplenomegaly, leukocytosis, and thrombocytosis during the acute infection. {ECO:0000269|PubMed:32163377}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB14724; DB05111; DB10770; DB10772; DB01296; DB01250; DB05110 Interacts with P15260; Q66793 EC number NA Uniprot keywords 3D-structure; Antiviral defense; Cleavage on pair of basic residues; Cytokine; Direct protein sequencing; Glycoprotein; Growth regulation; Pharmaceutical; Proteomics identification; Pyrrolidone carboxylic acid; Reference proteome; Secreted; Signal Protein physicochemical properties Chain ID A,D Molecular weight (Da) 28390 Length 242 Aromaticity 0.12 Instability index 18.95 Isoelectric point 8.42 Charge (pH=7) 1.71 3D Binding mode Sequence MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIDELIQVMAELGANVSGEFVKEAENLKKYFNDNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAA Hydrogen bonds contact Hydrophobic contact | ||||
| 85 | p-hydroxybenzoate hydroxylase | 1PBE | 3.93 | |
Target general information Gen name pobA Organism Pseudomonas fluorescens Uniprot ID TTD ID NA Synonyms NA Protein family Aromatic-ring hydroxylase family Biochemical class Oxidoreductase Function 4-hydroxybenzoate 3-monooxygenase activity.FAD binding.Flavin adenine dinucleotide binding. Related diseases Mitochondrial complex IV deficiency (MT-C4D) [MIM:220110]: A disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to severe multisystem disease affecting several tissues and organs. Features include hypertrophic cardiomyopathy, hepatomegaly and liver dysfunction, hypotonia, muscle weakness, exercise intolerance, developmental delay, delayed motor development and intellectual disability. Some affected individuals manifest a fatal hypertrophic cardiomyopathy resulting in neonatal death. A subset of patients manifest Leigh syndrome. {ECO:0000269|PubMed:10486321}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB02839; DB04242; DB02059; DB02362; DB03147 Interacts with NA EC number 1.14.13.2 Uniprot keywords 3D-structure; Aromatic hydrocarbons catabolism; Direct protein sequencing; FAD; Flavoprotein; Monooxygenase; NADP; Oxidoreductase Protein physicochemical properties Chain ID A Molecular weight (Da) 43949.7 Length 391 Aromaticity 0.09 Instability index 34.92 Isoelectric point 6.78 Charge (pH=7) -0.68 3D Binding mode Sequence MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYE Hydrogen bonds contact Hydrophobic contact | ||||
| 86 | D-amino acid oxidase (DAO) | 3ZNN | 3.93 | |
Target general information Gen name DAO Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Daminoacid oxidase; DAMOX; DAAO Protein family DAMOX/DASOX family Biochemical class CH-NH(2) donor oxidoreductase Function Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids. Related diseases Schizophrenia (SCZD) [MIM:181500]: A complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder. {ECO:0000269|PubMed:12364586}. Disease susceptibility may be associated with variants affecting the gene represented in this entry.; DISEASE: Amyotrophic lateral sclerosis (ALS) [MIM:105400]: A neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases. {ECO:0000269|PubMed:20368421, ECO:0000269|PubMed:20538972, ECO:0000269|PubMed:22203986, ECO:0000269|PubMed:23219954, ECO:0000269|PubMed:24138986, ECO:0000269|PubMed:25701391, ECO:0000269|PubMed:37558109, ECO:0000269|PubMed:38035964, ECO:0000269|PubMed:38134563}. Disease susceptibility may be associated with variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB07979; DB02838; DB04166; DB03793; DB03225; DB03147; DB03531; DB02988 Interacts with Q9P2K6; O43741 EC number EC 1.4.3.3 Uniprot keywords 3D-structure; Amyotrophic lateral sclerosis; Cell projection; Cytoplasm; Disease variant; FAD; Flavoprotein; Neurodegeneration; Oxidoreductase; Peroxisome; Phosphoprotein; Proteomics identification; Reference proteome; S-nitrosylation; Schizophrenia; Secreted; Synapse Protein physicochemical properties Chain ID A,B Molecular weight (Da) 38654.6 Length 340 Aromaticity 0.11 Instability index 29.13 Isoelectric point 6.18 Charge (pH=7) -4.45 3D Binding mode Sequence MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLS Hydrogen bonds contact Hydrophobic contact | ||||
| 87 | Thymidylate synthase (TYMS) | 1HVY | 3.93 | |
Target general information Gen name TYMS Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms TSase; TS Protein family Thymidylate synthase family Biochemical class Methyltransferase Function Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Related diseases Dyskeratosis congenita, digenic (DKCD) [MIM:620040]: A form of dyskeratosis congenita, a rare multisystem disorder caused by defective telomere maintenance. It is characterized by progressive bone marrow failure, and the clinical triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. Common but variable features include premature graying, aplastic anemia, low platelets, osteoporosis, pulmonary fibrosis, and liver fibrosis among others. Early mortality is often associated with bone marrow failure, infections, fatal pulmonary complications, or malignancy. DKCD transmission pattern is consistent with digenic inheritance. {ECO:0000269|PubMed:35931051}. The disease is caused by variants affecting distinct genetic loci, including the gene represented in this entry. TYMS germline variants in the presence of a common ENOSF1 haplotype (defined by rs699517, rs2790 and rs1512643) result in severe thymidylate synthase deficiency and disease. The pathogenic mechanism involves increased expression of ENOSF1 relative to TYMS, and post-transcriptional inhibition of TYMS translation through ENOSF1-TYMS RNA-RNA interactions. {ECO:0000269|PubMed:35931051}. Drugs (DrugBank ID) DB03541; DB07577; DB08734; DB05308; DB01101; DB03800; DB00322; DB00544; DB00441; DB00563; DB08479; DB08478; DB05457; DB00642; DB06813; DB00293; DB04530; DB09256; DB09327; DB05116; DB01643; DB00432 Interacts with NA EC number EC 2.1.1.45 Uniprot keywords 3D-structure; Alternative splicing; Cytoplasm; Direct protein sequencing; Disease variant; Dyskeratosis congenita; Isopeptide bond; Membrane; Methyltransferase; Mitochondrion; Mitochondrion inner membrane; Nucleotide biosynthesis; Nucleus; Phosphoprotein; Proteomics identification; Reference proteome; Transferase; Ubl conjugation Protein physicochemical properties Chain ID A,B,C,D Molecular weight (Da) 32889.3 Length 287 Aromaticity 0.1 Instability index 40.61 Isoelectric point 6.57 Charge (pH=7) -1.26 3D Binding mode Sequence PPHGELQYLGQIQHILRGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV Hydrogen bonds contact Hydrophobic contact | ||||
| 88 | Non-heme chloroperoxidase | 1A8U | 3.93 | |
Target general information Gen name cpo Organism Kitasatospora aureofaciens (Streptomyces aureofaciens) Uniprot ID TTD ID NA Synonyms cpoT Protein family AB hydrolase superfamily, Bacterial non-heme haloperoxidase / perhydrolase family Biochemical class Haloperoxidase Function Chloride peroxidase activity. Related diseases Hypervalinemia and hyperleucine-isoleucinemia (HVLI) [MIM:618850]: An autosomal recessive metabolic disorder characterized by highly elevated plasma concentrations of valine and leucine/isoleucine. Affected individuals suffer from headache and mild memory impairment. {ECO:0000269|PubMed:25653144}. The disease is caused by variants affecting the gene represented in this entry. A patient with hypervalinemia and hyperleucine-isoleucinemia was identified as compound heterozygote for Gln-170 (inherited from his father) and Lys-264 (inherited from his mother), both variants reduced the catalytic activity of the enzyme. After treatment with vitamin B6, a precursor of pyridoxal 5'-phosphate, a BCAT2 cofactor, the blood levels of branched chain amino acids, especially valine, were decreased and brain lesions were improved. {ECO:0000269|PubMed:25653144}. Drugs (DrugBank ID) DB03793 Interacts with NA EC number 1.11.1.- Uniprot keywords 3D-structure; Chloride; Oxidoreductase; Peroxidase Protein physicochemical properties Chain ID A,B Molecular weight (Da) 60428.4 Length 554 Aromaticity 0.13 Instability index 31.26 Isoelectric point 4.65 Charge (pH=7) -32.72 3D Binding mode Sequence PFITVGQENSTSIDLYYEDHGAGQPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTVLETLDLQDAVLVGFSMGTGEVARYVSSYGTARIAKVAFLASLEPFLLKTDDNPDGAAPKEFFDGIVAAVKADRYAFYTGFFNDFYNLDENLGTRISEEAVRNSWNTAASGGFFAAAAAPTTWYTDFRADIPRIDVPALILHGTGDRTLPIENTARVFHKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLAKPFITVGQENSTSIDLYYEDHGAGQPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTVLETLDLQDAVLVGFSMGTGEVARYVSSYGTARIAKVAFLASLEPFLLKTDDNPDGAAPKEFFDGIVAAVKADRYAFYTGFFNDFYNLDENLGTRISEEAVRNSWNTAASGGFFAAAAAPTTWYTDFRADIPRIDVPALILHGTGDRTLPIENTARVFHKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLAK Hydrogen bonds contact Hydrophobic contact | ||||
| 89 | Ornithine decarboxylase (ODC1) | 2OO0 | 3.93 | |
Target general information Gen name ODC1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms ODC Protein family Orn/Lys/Arg decarboxylase class-II family Biochemical class Carbon-carbon lyase Function Polyamines are essential for cell proliferation and are implicated in cellular processes, ranging from DNA replication to apoptosis. Catalyzes the first and rate-limiting step of polyamine biosynthesis that converts ornithine into putrescine, which is the precursor for the polyamines, spermidine and spermine. Related diseases Bachmann-Bupp syndrome (BABS) [MIM:619075]: An autosomal dominant disorder characterized by global developmental delay, alopecia, absolute or relative macrocephaly, and facial dysmorphism. Neuroimaging shows white matter abnormalities, prominent Virchow-Robin spaces, periventricular cysts, and abnormalities of the corpus callosum. {ECO:0000269|PubMed:30239107, ECO:0000269|PubMed:30475435}. The disease is caused by variants affecting the gene represented in this entry. BABS is due to truncating variants that lead to a gain of function. This phenomenon apparently results from truncation proximal to or involving the C-terminal region of ODC1 protein, distal enough to allow escape from nonsense-mediated decay. A gain of function is corroborated by elevated plasma levels of N-acetylputrescine, with otherwise normal polyamine levels, in affected individuals. {ECO:0000269|PubMed:30475435}. Drugs (DrugBank ID) DB06243; DB04263; DB03856; DB04083; DB02824; DB01917; DB00114; DB02209; DB00203; DB00127; DB00313 Interacts with Q9H8Y8; Q92993; Q9UMX2; Q9UMX2-2 EC number EC 4.1.1.17 Uniprot keywords 3D-structure; Decarboxylase; Disease variant; Hypotrichosis; Lyase; Phosphoprotein; Polyamine biosynthesis; Proteomics identification; Pyridoxal phosphate; Reference proteome; S-nitrosylation Protein physicochemical properties Chain ID A,B Molecular weight (Da) 45682.9 Length 410 Aromaticity 0.11 Instability index 40.93 Isoelectric point 5.61 Charge (pH=7) -6.68 3D Binding mode Sequence LMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQFQN Hydrogen bonds contact Hydrophobic contact | ||||
| 90 | Macrophage colony-stimulating factor 1 receptor (CSF1R) | 2I1M | 3.93 | |
Target general information Gen name CSF1R Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Proto-oncogene c-Fms; M-CSF-R; FMS; CSF-1R; CSF-1-R; CSF-1 receptor; CD115 Protein family Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily Biochemical class Kinase Function Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding. Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor. Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Related diseases Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers.; DISEASE: Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection.; DISEASE: Leukoencephalopathy, hereditary diffuse, with spheroids 1 (HDLS1) [MIM:221820]: An autosomal dominant adult-onset rapidly progressive neurodegenerative disorder characterized by variable behavioral, cognitive, and motor changes. Patients often die of dementia within 6 years of onset. Brain imaging shows patchy abnormalities in the cerebral white matter, predominantly affecting the frontal and parietal lobes. {ECO:0000269|PubMed:22197934, ECO:0000269|PubMed:23408870, ECO:0000269|PubMed:24336230, ECO:0000269|PubMed:24532199}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Brain abnormalities, neurodegeneration, and dysosteosclerosis (BANDDOS) [MIM:618476]: An autosomal recessive disease with variable manifestations. Main features are brain malformations with calcifying leukoencephalopathy, progressive neurodegeneration, and bone sclerotic features. The age at onset ranges from infancy to early adulthood. Neurologic features include loss of previous motor and language skills, cognitive impairment, spasticity, and focal seizures. Brain imaging shows periventricular white matter abnormalities and calcifications, large cisterna magna or Dandy-Walker malformation, and sometimes agenesis of the corpus callosum. {ECO:0000269|PubMed:30982608, ECO:0000269|PubMed:30982609}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB07167; DB07202; DB12147; DB12010; DB00619; DB06080; DB12978; DB01268 Interacts with P09603; Q15375; P29323; Q6ZMJ4-1 EC number EC 2.7.10.1 Uniprot keywords 3D-structure; Alternative splicing; ATP-binding; Cell membrane; Disease variant; Disulfide bond; Glycoprotein; Immunity; Immunoglobulin domain; Inflammatory response; Innate immunity; Kinase; Membrane; Neurodegeneration; Nucleotide-binding; Phosphoprotein; Proteomics identification; Proto-oncogene; Receptor; Reference proteome; Repeat; Signal; Transferase; Transmembrane; Transmembrane helix; Tyrosine-protein kinase; Ubl conjugation Protein physicochemical properties Chain ID A Molecular weight (Da) 35082.9 Length 311 Aromaticity 0.11 Instability index 44.6 Isoelectric point 8.13 Charge (pH=7) 2.42 3D Binding mode Sequence QVRWKIIESYNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKSRVLETDSTASTRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQEDRRER Hydrogen bonds contact Hydrophobic contact | ||||
| 91 | Farnesyl pyrophosphate synthase | 4NUA | 3.93 | |
Target general information Gen name FDPS Organism Homo sapiens (Human) Uniprot ID TTD ID NA Synonyms KIAA1293;FPS Protein family FPP/GGPP synthase family Biochemical class Transferase Function Dimethylallyltranstransferase activity.Geranyltranstransferase activity.Metal ion binding.RNA binding. Related diseases Porokeratosis 9, multiple types (POROK9) [MIM:616631]: A form of porokeratosis, a disorder of faulty keratinization characterized by one or more atrophic patches surrounded by a distinctive hyperkeratotic ridgelike border called the cornoid lamella. The keratotic lesions can progress to overt cutaneous neoplasms, typically squamous cell carcinomas. Multiple clinical variants of porokeratosis are recognized, including porokeratosis of Mibelli, linear porokeratosis, disseminated superficial actinic porokeratosis, palmoplantar porokeratosis, and punctate porokeratosis. Different clinical presentations can be observed among members of the same family. Individuals expressing more than one variant have also been reported. {ECO:0000269|PubMed:26202976}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB00630; DB01785; DB07780; DB02552; DB07841; DB00710; DB06255; DB04714; DB02508; DB06548; DB00282; DB00884; DB00399 Interacts with O95870; P54253; Q6ZMZ0; Q9BRI3; Q8WWF3 EC number 2.5.1.1; 2.5.1.10 Uniprot keywords 3D-structure; Acetylation; Alternative splicing; Cholesterol biosynthesis; Cholesterol metabolism; Cytoplasm; Disease variant; Host-virus interaction; Hydroxylation; Isoprene biosynthesis; Lipid biosynthesis; Lipid metabolism; Magnesium; Metal-binding; Proteomics identification; Reference proteome; Steroid biosynthesis; Steroid metabolism; Sterol biosynthesis; Sterol metabolism; Transferase Protein physicochemical properties Chain ID A Molecular weight (Da) 38722.9 Length 338 Aromaticity 0.12 Instability index 45.6 Isoelectric point 5.1 Charge (pH=7) -9.86 3D Binding mode Sequence AYAQEKQDFVQHFSQIVRVLTEHPEIGDAIARLKEVLEYNTIGGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFAQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYK Hydrogen bonds contact Hydrophobic contact | ||||
| 92 | Retinoic acid receptor beta (RARB) | 4DM6 | 3.93 | |
Target general information Gen name RARB Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms RAR-epsilon; RAR-beta; Nuclear receptor subfamily 1 group B member 2; NR1B2; HBV-activated protein; HAP Protein family Nuclear hormone receptor family, NR1 subfamily Biochemical class Nuclear hormone receptor Function Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence or presence of hormone ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function. Receptor for retinoic acid. Related diseases Microphthalmia, syndromic, 12 (MCOPS12) [MIM:615524]: A form of microphthalmia, a disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS12 patients manifest variable features, including diaphragmatic hernia, pulmonary hypoplasia, and cardiac abnormalities. {ECO:0000269|PubMed:24075189, ECO:0000269|PubMed:27120018}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB00459; DB00210; DB00523; DB02877; DB00926; DB05785; DB04942; DB00799; DB00755; DB12808 Interacts with O95273; P50222; Q9UBK2; P62195; P28702; P28702-3; P48443; P03255 EC number NA Uniprot keywords 3D-structure; Alternative splicing; Cytoplasm; Disease variant; DNA-binding; Metal-binding; Microphthalmia; Nucleus; Phosphoprotein; Proto-oncogene; Receptor; Reference proteome; Transcription; Transcription regulation; Zinc; Zinc-finger Protein physicochemical properties Chain ID A,B Molecular weight (Da) 25904.1 Length 229 Aromaticity 0.06 Instability index 44.34 Isoelectric point 7.55 Charge (pH=7) 0.73 3D Binding mode Sequence TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLEN Hydrogen bonds contact Hydrophobic contact | ||||
| 93 | Cytoplasmic aspartate aminotransferase (GOT1) | 3II0 | 3.93 | |
Target general information Gen name GOT1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Glutamate oxaloacetate transaminase-1; GOT1 Protein family Class-I pyridoxal-phosphate-dependent aminotransferase family Biochemical class Transaminase Function Biosynthesis of L-glutamate from L-aspartate or L- cysteine. Important regulator of levels of glutamate, the major excitatory neurotransmitter of the vertebrate central nervous system. Acts as a scavenger of glutamate in brain neuroprotection. The aspartate aminotransferase activity is involved in hepatic glucose synthesis during development and in adipocyte glyceroneogenesis. Using L-cysteine as substrate, regulates levels of mercaptopyruvate, an important source of hydrogen sulfide. Mercaptopyruvate is converted into H(2)S via the action of 3- mercaptopyruvate sulfurtransferase (3MST). Hydrogen sulfide is an important synaptic modulator and neuroprotectant in the brain. Related diseases Multiple fibroadenomas of the breast (MFAB) [MIM:615554]: A benign breast disease marked by lobuloalveolar growth with abnormally high proliferation of the epithelium, and characterized by the presence of more than 3 fibroadenomas in one breast. Fibroadenomas are adenomas containing fibrous tissue. {ECO:0000269|PubMed:18779591}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Hyperprolactinemia (HPRL) [MIM:615555]: A disorder characterized by increased levels of prolactin in the blood not associated with gestation or the puerperium. HPRL may result in infertility, hypogonadism, and galactorrhea. {ECO:0000269|PubMed:24195502}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB00210; DB00128; DB09130; DB00151; DB00142; DB04299; DB00114 Interacts with NA EC number EC 2.6.1.1 Uniprot keywords 3D-structure; Alternative splicing; Amino-acid biosynthesis; Aminotransferase; Cytoplasm; Direct protein sequencing; Phosphoprotein; Proteomics identification; Pyridoxal phosphate; Reference proteome; Transferase Protein physicochemical properties Chain ID A,B,C,D Molecular weight (Da) 51732.3 Length 462 Aromaticity 0.1 Instability index 31.83 Isoelectric point 7.48 Charge (pH=7) 0.86 3D Binding mode Sequence PVLVFKLTVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRVQSLGGTGALRIGADEKIVRITWSNPMQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEA Hydrogen bonds contact Hydrophobic contact | ||||
| 94 | Vascular endothelial growth factor receptor 1 (FLT-1) | 5EX3 | 3.93 | |
Target general information Gen name FLT1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Vascular permeability factor receptor; VEGFR1; VEGFR-1; VEGF-1 receptor; Tyrosine-protein kinase receptor FLT; Tyrosine-protein kinase FRT; Fms-like tyrosine kinase 1; FRT; FLT Protein family Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily Biochemical class Kinase Function May play an essential role as a negative regulator of embryonic angiogenesis by inhibiting excessive proliferation of endothelial cells. Can promote endothelial cell proliferation, survival and angiogenesis in adulthood. Its function in promoting cell proliferation seems to be cell-type specific. Promotes PGF-mediated proliferation of endothelial cells, proliferation of some types of cancer cells, but does not promote proliferation of normal fibroblasts (in vitro). Has very high affinity for VEGFA and relatively low protein kinase activity; may function as a negative regulator of VEGFA signaling by limiting the amount of free VEGFA and preventing its binding to KDR. Likewise, isoforms lacking a transmembrane domain, such as isoform 2, isoform 3 and isoform 4, may function as decoy receptors for VEGFA. Modulates KDR signaling by forming heterodimers with KDR. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate and the activation of protein kinase C. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leading to activation of phosphatidylinositol kinase and the downstream signaling pathway. Mediates activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Phosphorylates SRC and YES1, and may also phosphorylate CBL. Isoform 1 phosphorylates PLCG. Promotes phosphorylation of AKT1 at 'Ser-473'. Promotes phosphorylation of PTK2/FAK1. Isoform 7 has a truncated kinase domain; it increases phosphorylation of SRC at 'Tyr-418' by unknown means and promotes tumor cell invasion. Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFB and PGF, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, chemotaxis, and cancer cell invasion. Related diseases Can contribute to cancer cell survival, proliferation, migration, and invasion, and tumor angiogenesis and metastasis. May contribute to cancer pathogenesis by promoting inflammatory responses and recruitment of tumor-infiltrating macrophages.; DISEASE: Abnormally high expression of soluble isoforms (isoform 2, isoform 3 or isoform 4) may be a cause of preeclampsia. Drugs (DrugBank ID) DB06626; DB05932; DB10770; DB12010; DB11679; DB06101; DB09078; DB06080; DB07288; DB09079; DB05913; DB06589; DB09221; DB08896; DB15685; DB00398; DB01268; DB05075; DB11800; DB04879 Interacts with P22681; P46109; P49763; P27986; Q12913; P15692; P15692-4; PRO_0000391621 [P98160]; PRO_0000391622 [P98160] EC number EC 2.7.10.1 Uniprot keywords 3D-structure; Alternative splicing; Angiogenesis; ATP-binding; Cell membrane; Chemotaxis; Cytoplasm; Developmental protein; Differentiation; Direct protein sequencing; Disulfide bond; Endosome; Glycoprotein; Immunoglobulin domain; Kinase; Membrane; Nucleotide-binding; Phosphoprotein; Proteomics identification; Receptor; Reference proteome; Repeat; Secreted; Signal; Transferase; Transmembrane; Transmembrane helix; Tyrosine-protein kinase; Ubl conjugation Protein physicochemical properties Chain ID D Molecular weight (Da) 49666.3 Length 435 Aromaticity 0.08 Instability index 43.84 Isoelectric point 7.05 Charge (pH=7) 0.14 3D Binding mode Sequence MEPLKVEKFATANRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDRKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRASKLGXSLG Hydrogen bonds contact Hydrophobic contact | ||||
| 95 | Diamine oxidase (AOC1) | 3HIG | 3.93 | |
Target general information Gen name AOC1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Kidney amine oxidase; KAO; Histaminase; Amiloride-binding protein; AOC1; ABP Protein family Copper/topaquinone oxidase family Biochemical class CH-NH(2) donor oxidoreductase Function Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function. Related diseases Lichtenstein-Knorr syndrome (LIKNS) [MIM:616291]: An autosomal recessive neurologic disorder characterized by progressive cerebellar ataxia and severe progressive sensorineural hearing loss. {ECO:0000269|PubMed:25205112, ECO:0000269|PubMed:30237576}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB00594; DB01373; DB09130; DB03608; DB05383 Interacts with Q15038; O75593; Q8IUC2; Q96HA8; Q7Z3K3; Q6ZRY4; Q01085-2; O43711; Q96K80 EC number EC 1.4.3.22 Uniprot keywords 3D-structure; Alternative splicing; Calcium; Cell membrane; Copper; Direct protein sequencing; Disulfide bond; Glycoprotein; Heparin-binding; Membrane; Metal-binding; Oxidoreductase; Proteomics identification; Reference proteome; Secreted; Signal; TPQ Protein physicochemical properties Chain ID A,B Molecular weight (Da) 69037.3 Length 607 Aromaticity 0.13 Instability index 43.33 Isoelectric point 6.52 Charge (pH=7) -4.61 3D Binding mode Sequence RKAGVFSDLSNQELKAVHSFLWSKKELRLQPSSTTTMAKNTVFLIEMLLPKKYHVLRFLDKGERHPVREARAVIFFGDQEHPNVTEFAVGPLPGPCYMRALSPRPGYQSSWASRPISTAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWAVEQVWYNGKFYGSPEELARKYADGEVDVVVLEPPLFSSLVQPHGPRFRLEGNAVLYGGWSFAFRLRSSSGLQVLNVHFGGERIAYEVSVQEAVALYGGHTPAGMQTKYLDVGWGLGSVTHELAPGIDCPETATFLDTFHYYDADDPVHYPRALCLFEMPTGVPLKGQVLVLRTTSTVYNXDYIWDFIFYPNGVMEAKMHATGYVHATFYTPEGLRHGTRLHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHSMADQVLPPGWQEEQAITWARYPLAVTKYRESELCSSSIYHQNDPWDPPVVFEQFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNFNGTYRPV Hydrogen bonds contact Hydrophobic contact | ||||
| 96 | p-hydroxybenzoate hydroxylase | 1K0I | 3.93 | |
Target general information Gen name pobA Organism Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Uniprot ID TTD ID NA Synonyms PA0247 Protein family Aromatic-ring hydroxylase family Biochemical class Hydrolase Function 4-hydroxybenzoate 3-monooxygenase activity.FAD binding.Flavin adenine dinucleotide binding. Related diseases Immunodeficiency, common variable, 12, with autoimmunity (CVID12) [MIM:616576]: A primary immunodeficiency characterized by hypogammaglobulinemia and recurrent bacterial infections. About half of patients develop autoimmune features, including cytopenia, as well as generalized inflammation and lymphoproliferation manifest as lymphadenopathy or hepatosplenomegaly. {ECO:0000269|PubMed:26279205}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB02839; DB04242; DB03482; DB02362; DB03147 Interacts with NA EC number 1.14.13.2 Uniprot keywords 3D-structure; Aromatic hydrocarbons catabolism; FAD; Flavoprotein; Monooxygenase; NADP; Oxidoreductase; Reference proteome Protein physicochemical properties Chain ID A Molecular weight (Da) 44295 Length 394 Aromaticity 0.09 Instability index 37.66 Isoelectric point 6.2 Charge (pH=7) -3.67 3D Binding mode Sequence MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSQYYVQVPLSEKVEDWSDERFWTELKARLPSEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEEIE Hydrogen bonds contact Hydrophobic contact | ||||
| 97 | Serine--pyruvate aminotransferase | 5HHY | 3.93 | |
Target general information Gen name AGXT Organism Homo sapiens (Human) Uniprot ID TTD ID NA Synonyms AGT1;SPAT Protein family Class-V pyridoxal-phosphate-dependent aminotransferase family Biochemical class Transferase Function Alanine-glyoxylate transaminase activity.Amino acid binding.Identical protein binding.Protein homodimerization activity.Protein self-association.Pyridoxal phosphate binding.Receptor binding.Serine-pyruvate transaminase activity.Transaminase activity. Related diseases Hyperoxaluria primary 1 (HP1) [MIM:259900]: An inborn error of glyoxylate metabolism characterized by increased excretion of oxalate and glycolate, and progressive tissue accumulation of insoluble calcium oxalate. Affected individuals are at risk for nephrolithiasis, nephrocalcinosis and early onset end-stage renal disease. {ECO:0000269|PubMed:10394939, ECO:0000269|PubMed:10453743, ECO:0000269|PubMed:10541294, ECO:0000269|PubMed:10862087, ECO:0000269|PubMed:10960483, ECO:0000269|PubMed:12559847, ECO:0000269|PubMed:12777626, ECO:0000269|PubMed:1301173, ECO:0000269|PubMed:1349575, ECO:0000269|PubMed:15253729, ECO:0000269|PubMed:15849466, ECO:0000269|PubMed:15961946, ECO:0000269|PubMed:15963748, ECO:0000269|PubMed:16971151, ECO:0000269|PubMed:1703535, ECO:0000269|PubMed:17495019, ECO:0000269|PubMed:2039493, ECO:0000269|PubMed:23229545, ECO:0000269|PubMed:24055001, ECO:0000269|PubMed:24934730, ECO:0000269|PubMed:26149463, ECO:0000269|PubMed:8101040, ECO:0000269|PubMed:9192270, ECO:0000269|PubMed:9604803}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB08060; DB00160; DB02079; DB00145; DB04083; DB00114; DB00133 Interacts with Q5BKX5-3; P21549; P0C7T5; Q9NR55; Q9H5F2; Q9UKJ5; A8MQ03; O43281-2; A1KXE4-2; Q5TD97; P49356; P53539; P49639; Q15323; O76011; O76014; Q6A162; Q07627; P60328; Q9BYR8; Q3LI67; Q8IUC2; Q9BYQ4; O60711; Q99750; Q5VZ52; P0DPK4; O43482; P50542-1; O15496; Q6ZR37; Q9NQX0; Q8HWS3; Q5W111-2; Q8WVR3; Q6DKK2 EC number 2.6.1.44; 2.6.1.51 Uniprot keywords 3D-structure; Acetylation; Aminotransferase; Disease variant; Peroxisome; Phosphoprotein; Proteomics identification; Pyridoxal phosphate; Reference proteome; Transferase Protein physicochemical properties Chain ID A,B Molecular weight (Da) 84537 Length 771 Aromaticity 0.07 Instability index 36.81 Isoelectric point 8.42 Charge (pH=7) 6.81 3D Binding mode Sequence LLVTPPKALLKPLSIPNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMYQIMDEIKEGIQYVFQTRNPLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKLLVTPPKALLKPLSIPNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMYQIMDEIKEGIQYVFQTRNPLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKK Hydrogen bonds contact Hydrophobic contact | ||||
| 98 | Histidine decarboxylase (HDC) | 4E1O | 3.93 | |
Target general information Gen name HDC Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Human histidine decarboxylase Protein family Group II decarboxylase family Biochemical class Carbon-carbon lyase Function Catalyzes the biosynthesis of histamine from histidine. Related diseases Corticosterone methyloxidase 1 deficiency (CMO-1 deficiency) [MIM:203400]: Autosomal recessive disorder of aldosterone biosynthesis. There are two biochemically different forms of selective aldosterone deficiency be termed corticosterone methyloxidase (CMO) deficiency type 1 and type 2. In CMO-1 deficiency, aldosterone is undetectable in plasma, while its immediate precursor, 18-hydroxycorticosterone, is low or normal. {ECO:0000269|PubMed:11238478, ECO:0000269|PubMed:8439335, ECO:0000269|PubMed:9177280}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Corticosterone methyloxidase 2 deficiency (CMO-2 deficiency) [MIM:610600]: Autosomal recessive disorder of aldosterone biosynthesis. In CMO-2 deficiency, aldosterone can be low or normal, but at the expense of increased secretion of 18-hydroxycorticosterone. Consequently, patients have a greatly increased ratio of 18-hydroxycorticosterone to aldosterone and a low ratio of corticosterone to 18-hydroxycorticosterone in serum. {ECO:0000269|PubMed:12788848, ECO:0000269|PubMed:1346492, ECO:0000269|PubMed:1594605, ECO:0000269|PubMed:9625333, ECO:0000269|PubMed:9814506}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB00117; DB00114 Interacts with Q86UW9 EC number EC 4.1.1.22 Uniprot keywords 3D-structure; Alternative splicing; Catecholamine biosynthesis; Decarboxylase; Lyase; Proteomics identification; Pyridoxal phosphate; Reference proteome Protein physicochemical properties Chain ID A,B,C,D,E,F Molecular weight (Da) 107706 Length 956 Aromaticity 0.1 Instability index 55.17 Isoelectric point 6.23 Charge (pH=7) -9.63 3D Binding mode Sequence GSMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESSLNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDXLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNSLTENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQGSMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESSLNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDXLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNSLTENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQ Hydrogen bonds contact Hydrophobic contact | ||||
| 99 | Beta-glucosidase A | 1E4I | 3.93 | |
Target general information Gen name bglA Organism Paenibacillus polymyxa (Bacillus polymyxa) Uniprot ID TTD ID NA Synonyms NA Protein family Glycosyl hydrolase 1 family Biochemical class Hydrolase Function Beta-glucosidase activity.Scopolin beta-glucosidase activity. Related diseases Schizophrenia (SCZD) [MIM:181500]: A complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder. {ECO:0000269|PubMed:15645182}. Disease susceptibility may be associated with variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB02658; DB04282; DB04304 Interacts with NA EC number 3.2.1.21 Uniprot keywords 3D-structure; Carbohydrate metabolism; Cellulose degradation; Glycosidase; Hydrolase; Polysaccharide degradation Protein physicochemical properties Chain ID A Molecular weight (Da) 51515.2 Length 447 Aromaticity 0.14 Instability index 38.44 Isoelectric point 5.28 Charge (pH=7) -18.1 3D Binding mode Sequence TIFQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTPGKVFNGDNGNVACDSYHRYEEDIRLMKELGIRTYRFSVSWPRIFPNGDGEVNQKGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQDAGGWGNRRTIQAFVQFAETMFREFHGKIQHWLTFNEPWCIAFLSNMLGVHAPGLTNLQTAIDVGHHLLVAHGLSVRRFRELGTSGQIGIAPNVSWAVPYSTSEEDKAACARTISLHSDWFLQPIYQGSYPQFLVDWFAEQGATVPIQDGDMDIIGEPIDMIGINYYSMSVNRFNPEAGFLQSEEINMGLPVTDIGWPVESRGLYEVLHYLQKYGNIDIYITENGACINDEVVNGKVQDDRRISYMQQHLVQVHRTIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHVDFRTQVRTPKQSYYWYRNVVSNNWLETRR Hydrogen bonds contact Hydrophobic contact | ||||