Ligand
Structure
Job ID
b5aa43c6924a21fc75a6162a600078fc
Job name
NA
Time
2026-03-04 17:25:26
| Rank | Target | PDB ID |
AirScore |
Detail |
|---|---|---|---|---|
| 41 | Sodium/glucose cotransporter 2 (SGLT2) | 7VSI | 8.38 | |
Target general information Gen name SLC5A2 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Solute carrier family 5 member 2; Na(+)/glucose cotransporter 2; Low affinity sodium-glucose cotransporter Protein family Sodium:solute symporter (SSF) (TC 2.A.21) family Biochemical class Solute:sodium symporter Function Has a Na(+) to glucose coupling ratio of 1:1. Sodium-dependent glucose transporter. Related diseases Renal glucosuria (GLYS) [MIM:233100]: A disorder characterized by persistent isolated glucosuria, normal fasting serum glucose concentration, decreased renal tubular resorption of glucose from the urine, and absence of any other signs of tubular dysfunction. {ECO:0000269|PubMed:14614622}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB12236; DB08907; DB01914; DB06292; DB09038; DB11827; DB12713 Interacts with O14556; Q13113 EC number NA Uniprot keywords 3D-structure; Alternative splicing; Cell membrane; Disease variant; Disulfide bond; Glycoprotein; Ion transport; Membrane; Metal-binding; Proteomics identification; Reference proteome; Sodium; Sodium transport; Sugar transport; Symport; Transmembrane; Transmembrane helix; Transport Protein physicochemical properties Chain ID A Molecular weight (Da) 63858.9 Length 586 Aromaticity 0.12 Instability index 39.46 Isoelectric point 8.62 Charge (pH=7) 7.41 3D Binding mode Sequence DNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTAGVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRCLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDRELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRVNEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLLTLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDEDISEDPSWARVVNLNALLMMAVAVFLWGFYA Hydrogen bonds contact Hydrophobic contact | ||||
| 42 | Aldo-keto reductase family 1 member C3 | 1S1P | 8.37 | |
Target general information Gen name AKR1C3 Organism Homo sapiens (Human) Uniprot ID TTD ID NA Synonyms PGFS;DDH1;HSD17B5;KIAA0119 Protein family Aldo/keto reductase family Biochemical class Oxidoreductase Function 15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity.Alditol:NADP+ 1-oxidoreductase activity.Aldo-keto reductase (NADP) activity.Androsterone dehydrogenase activity.Delta4-3-oxosteroid 5beta-reductase activity.Dihydrotestosterone 17-beta-dehydrogenase activity.Geranylgeranyl reductase activity.Indanol dehydrogenase activity.Ketoreductase activity.Ketosteroid monooxygenase activity.NADP-retinol dehydrogenase activity.Oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor.Phenanthrene 9,10-monooxygenase activity.Prostaglandin D2 11-ketoreductase activity.Prostaglandin-F synthase activity.Prostaglandin H2 endoperoxidase reductase activity.Retinal dehydrogenase activity.Retinol dehydrogenase activity.Testosterone 17-beta-dehydrogenase (NADP+) activity.Testosterone dehydrogenase (NAD+) activity.Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity. Related diseases Neurodevelopmental disorder with language impairment and behavioral abnormalities (NEDLIB) [MIM:618917]: A neurodevelopmental disorder characterized by global developmental delay, impaired intellectual development, poor or absent speech, and behavioral abnormalities, such as autism spectrum disorder, repetitive behaviors, and hyperactivity. Some patients develop seizures and manifest developmental regression. {ECO:0000269|PubMed:31300657}. The disease is caused by variants affecting the gene represented in this entry. The genetic variation producing the missense variant p.Q607E, associated with NEDLIB, is predicted to deeply affect RNA editing. In a physiological context, the adenosine (A) residue of the original glutamine (Q) codon CAG is post-transcriptionaly edited to inosine (I) by ADAR2, leading to a codon recognized by the ribosome as arginine (R). The glutamate (E) codon GAG, resulting from the genetic variation, is predicted to be edited 90% less than the normal CAG codon. If edited, the codon GIG would be translated as p.Q607G. {ECO:0000305|PubMed:31300657}. Drugs (DrugBank ID) DB07700; DB01561; DB01536; DB00997; DB01039; DB02266; DB13751; DB00328; DB06077; DB00959; DB00157; DB03461; DB09074; DB00776; DB02056; DB01698; DB02901 Interacts with P17516 EC number 1.1.1.-; 1.1.1.188; 1.1.1.210; 1.1.1.239; 1.1.1.357; 1.1.1.53; 1.1.1.62; 1.1.1.64 Uniprot keywords 3D-structure; Alternative splicing; Cytoplasm; Lipid metabolism; NAD; NADP; Oxidoreductase; Proteomics identification; Reference proteome Protein physicochemical properties Chain ID A Molecular weight (Da) 35846.8 Length 315 Aromaticity 0.09 Instability index 47.59 Isoelectric point 8.54 Charge (pH=7) 4.51 3D Binding mode Sequence QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS Hydrogen bonds contact Hydrophobic contact | ||||
| 43 | 3-oxo-5-beta-steroid 4-dehydrogenase | 3BUV | 8.37 | |
Target general information Gen name AKR1D1 Organism Homo sapiens (Human) Uniprot ID TTD ID NA Synonyms SRD5B1 Protein family Aldo/keto reductase family Biochemical class Oxidoreductase Function Aldo-keto reductase (NADP) activity.Delta4-3-oxosteroid 5beta-reductase activity.Steroid binding. Related diseases Congenital bile acid synthesis defect 2 (CBAS2) [MIM:235555]: A condition characterized by jaundice, intrahepatic cholestasis and hepatic failure. Patients with this liver disease show absence or low levels of chenodeoxycholic acid and cholic acid in plasma and urine. {ECO:0000269|PubMed:12970144, ECO:0000269|PubMed:15030995, ECO:0000269|PubMed:19175828, ECO:0000269|PubMed:20522910}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB07557; DB07447; DB00548; DB01216; DB00741; DB06077; DB00717 Interacts with Q04828 EC number 1.3.1.3 Uniprot keywords 3D-structure; Alternative splicing; Bile acid catabolism; Cytoplasm; Disease variant; Intrahepatic cholestasis; Lipid degradation; Lipid metabolism; NADP; Oxidoreductase; Proteomics identification; Reference proteome; Steroid metabolism Protein physicochemical properties Chain ID A,B Molecular weight (Da) 37245.3 Length 325 Aromaticity 0.1 Instability index 36.43 Isoelectric point 7.26 Charge (pH=7) 0.62 3D Binding mode Sequence DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY Hydrogen bonds contact Hydrophobic contact | ||||
| 44 | Fatty acid-binding protein 1 (FABP1) | 6MP4 | 8.37 | |
Target general information Gen name FABP1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms L-FABP; FABP1; 14-kDa fatty-acid binding protein; 14 kDa selenium-binding protein Protein family Calycin superfamily, Fatty-acid binding protein (FABP) family Biochemical class NA Function Binds free fatty acids andtheir coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. Related diseases Renal cell carcinoma (RCC) [MIM:144700]: Renal cell carcinoma is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma. Clear cell renal cell carcinoma is the most common subtype. {ECO:0000269|PubMed:20054297, ECO:0000269|PubMed:23622243, ECO:0000269|PubMed:23792563, ECO:0000269|PubMed:25728682}. The disease may be caused by variants affecting the gene represented in this entry. Defects of SETD2 are associated with loss of DNA methylation at non-promoter regions (PubMed:23792563). SETD2 defects lead to aberrant and reduced nucleosome compaction and chromatin association of key replication proteins, such as MCM7 and DNA polymerase delta, leading to hinder replication fork progression and prevent loading of RAD51 homologous recombination repair factor at DNA breaks (PubMed:25728682). {ECO:0000269|PubMed:23792563, ECO:0000269|PubMed:25728682}.; DISEASE: Luscan-Lumish syndrome (LLS) [MIM:616831]: An autosomal dominant syndrome with a variable phenotype. Clinical features include macrocephaly, distinctive facial appearance, postnatal overgrowth, various degrees of learning difficulties, autism spectrum disorder, and intellectual disability. {ECO:0000269|PubMed:23160955, ECO:0000269|PubMed:24852293, ECO:0000269|PubMed:26084711, ECO:0000269|PubMed:27317772}. The disease may be caused by variants affecting the gene represented in this entry.; DISEASE: Leukemia, acute lymphoblastic (ALL) [MIM:613065]: A subtype of acute leukemia, a cancer of the white blood cells. ALL is a malignant disease of bone marrow and the most common malignancy diagnosed in children. The malignant cells are lymphoid precursor cells (lymphoblasts) that are arrested in an early stage of development. The lymphoblasts replace the normal marrow elements, resulting in a marked decrease in the production of normal blood cells. Consequently, anemia, thrombocytopenia, and neutropenia occur to varying degrees. The lymphoblasts also proliferate in organs other than the marrow, particularly the liver, spleen, and lymphnodes. {ECO:0000269|PubMed:24509477, ECO:0000269|PubMed:24662245}. The disease may be caused by variants affecting distinct genetic loci, including the gene represented in this entry.; DISEASE: Leukemia, acute myelogenous (AML) [MIM:601626]: A subtype of acute leukemia, a cancer of the white blood cells. AML is a malignant disease of bone marrow characterized by maturational arrest of hematopoietic precursors at an early stage of development. Clonal expansion of myeloid blasts occurs in bone marrow, blood, and other tissue. Myelogenous leukemias develop from changes in cells that normally produce neutrophils, basophils, eosinophils and monocytes. {ECO:0000269|PubMed:16314571, ECO:0000269|PubMed:24509477}. The disease may be caused by variants affecting distinct genetic loci, including the gene represented in this entry.; DISEASE: Intellectual developmental disorder, autosomal dominant 70 (MRD70) [MIM:620157]: An autosomal dominant disorder characterized by mild global developmental delay, moderately impaired intellectual disability with speech difficulties, and behavioral abnormalities. {ECO:0000269|PubMed:32710489}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Rabin-Pappas syndrome (RAPAS) [MIM:620155]: An autosomal dominant neurodevelopmental disorder characterized by severely impaired global development, intellectual disability, microcephaly, facial dysmorphism, and variable congenital anomalies affecting the skeletal, genitourinary, cardiac, and other organ systems. {ECO:0000269|PubMed:32710489}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB02074; DB02659; DB04224; DB02216 Interacts with P54764; P21333-2; Q96EK6 EC number NA Uniprot keywords 3D-structure; Acetylation; Cytoplasm; Lipid-binding; Phosphoprotein; Proteomics identification; Reference proteome; Transport Protein physicochemical properties Chain ID A Molecular weight (Da) 15248.3 Length 136 Aromaticity 0.08 Instability index 30.43 Isoelectric point 5.93 Charge (pH=7) -1.14 3D Binding mode Sequence GTENLYFQSMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Hydrogen bonds contact Hydrophobic contact | ||||
| 45 | Nitric-oxide synthase endothelial (NOS3) | 4D1P | 8.36 | |
Target general information Gen name NOS3 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Nitric oxide synthase, endothelial; NOSIII; NOS,type III; NOS type III; Endothelial nitric oxide synthase; Endothelial NOS; ENOS; EC-NOS; Constitutive NOS; CNOS Protein family NOS family Biochemical class Paired donor oxygen oxidoreductase Function NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets. Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. Related diseases Variation Asp-298 in NOS3 may be associated with susceptibility to coronary spasm. {ECO:0000269|PubMed:11740345, ECO:0000269|PubMed:9737779}. Drugs (DrugBank ID) DB07001; DB02048; DB02911; DB02335; DB01997; DB03332; DB04534; DB07244; DB03100; DB03918; DB02207; DB03065; DB00125; DB02994; DB01833; DB00155; DB00997; DB07388; DB03974; DB02077; DB01821; DB09237; DB01110; DB03144; DB03305; DB01686; DB04559; DB02044; DB08019; DB08018; DB02027; DB02979; DB00435; DB04223; DB06154; DB03910; DB02141; DB03963; DB03707; DB02234; DB04018; DB00360; DB02589 Interacts with P60709; P63010-2; Q8N6T3-3; Q9Y575-3; Q96FT7-4; Q5SZD1; Q16543; Q9UNS2; Q8IUI8; P35222; Q05193; O15287; Q08379; Q71DI3; P69905; P61978; Q12891; Q9UKT9; Q9Y2M5; Q14525; Q6DKI2; P43364-2; Q8N6F8; O94851; A4FUJ8; Q8N594; Q8IVI9; Q6X4W1-6; O15381-5; Q9NV79; Q16549; Q5T2W1; O75925; Q96I34; Q6ZMI0-5; P57052; Q9GZR2; Q96D59; Q8N6K7-2; Q9GZS3; Q8IUW3; Q7Z699; Q7Z698; P50502; Q9BR01-2; Q9NVV9; Q86WT6-2; Q9H347; P58304; Q9NZC7-5; Q9UNY5; P14079 EC number EC 1.14.13.39 Uniprot keywords 3D-structure; Alternative splicing; Calcium; Calmodulin-binding; Cell membrane; Cytoplasm; Cytoskeleton; Direct protein sequencing; FAD; Flavoprotein; FMN; Golgi apparatus; Heme; Iron; Lipoprotein; Membrane; Metal-binding; Myristate; NADP; Oxidoreductase; Palmitate; Phosphoprotein; Proteomics identification; Reference proteome; Zinc Protein physicochemical properties Chain ID A,B Molecular weight (Da) 90790.1 Length 803 Aromaticity 0.11 Instability index 50.67 Isoelectric point 6.03 Charge (pH=7) -9.56 3D Binding mode Sequence FPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW Hydrogen bonds contact Hydrophobic contact | ||||
| 46 | Retinoic acid receptor RXR-beta (RXRB) | 5HJP | 8.36 | |
Target general information Gen name RXRB Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Retinoid X receptor beta; Nuclear receptor subfamily 2 group B member 2; NR2B2 Protein family Nuclear hormone receptor family, NR2 subfamily Biochemical class Nuclear hormone receptor Function Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE). Receptor for retinoic acid. Related diseases Noonan syndrome 13 (NS13) [MIM:619087]: A form of Noonan syndrome, a disease characterized by short stature, facial dysmorphic features such as hypertelorism, a downward eyeslant and low-set posteriorly rotated ears, and a high incidence of congenital heart defects and hypertrophic cardiomyopathy. Other features can include a short neck with webbing or redundancy of skin, deafness, motor delay, variable intellectual deficits, multiple skeletal defects, cryptorchidism, and bleeding diathesis. Individuals with Noonan syndrome are at risk of juvenile myelomonocytic leukemia, a myeloproliferative disorder characterized by excessive production of myelomonocytic cells. NS13 inheritance is autosomal dominant. There is considerable variability in severity. {ECO:0000269|PubMed:32721402}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB08175; DB00459; DB00210; DB00523; DB00307; DB01393; DB03756; DB00926; DB01941; DB07929; DB02746; DB00412; DB00799; DB07080; DB00755 Interacts with Q00975; Q9HB07; F1D8P7; Q13133; Q13133-3; Q96RI1-1; P04150; Q9NRD5; P37231; P10276; P10276-2; P10826-2; P13631; Q6IQ16; Q13137; Q96B26; Q08379; Q6A162; Q9UJV3-2; Q13133-3; Q96RI1-1; O43586; P10276; P10826-2; Q8IUQ4-2; O75528; Q12800; Q9UBB9; Q05BL1; P14373; O94972; Q96S82 EC number NA Uniprot keywords 3D-structure; Alternative splicing; Cytoplasm; DNA-binding; Metal-binding; Methylation; Nucleus; Proteomics identification; Receptor; Reference proteome; Transcription; Transcription regulation; Zinc; Zinc-finger Protein physicochemical properties Chain ID A,C Molecular weight (Da) 28845.8 Length 251 Aromaticity 0.08 Instability index 54.86 Isoelectric point 6.74 Charge (pH=7) -0.6 3D Binding mode Sequence QLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPSASQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHEGSGSGSHKILHRLLQD Hydrogen bonds contact Hydrophobic contact | ||||
| 47 | TetR family transcriptional regulator | 2V57 | 8.36 | |
Target general information Gen name lfrR Organism Mycolicibacterium smegmatis (Mycobacterium smegmatis) Uniprot ID TTD ID NA Synonyms NA Protein family NA Biochemical class Transcription Function DNA binding. Related diseases LTC4 synthase deficiency is associated with a neurometabolic developmental disorder characterized by muscular hypotonia, psychomotor retardation, failure to thrive, and microcephaly. {ECO:0000269|PubMed:10896305, ECO:0000269|PubMed:9820300}. Drugs (DrugBank ID) DB01123 Interacts with NA EC number NA Uniprot keywords 3D-structure Protein physicochemical properties Chain ID A,B,C,D Molecular weight (Da) 37947.8 Length 348 Aromaticity 0.07 Instability index 36.27 Isoelectric point 5.5 Charge (pH=7) -9.3 3D Binding mode Sequence GARERTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYYPERTDLLRALARHVHDLSNAAIERADPTSGPVDAALRRVVESQLDLGPIVLFVYYEPSILADPELAAYFDIGDEAIVEVLNRASTERYPPGWARRVFWALMQAGYEAAKDGMPRHQIVDAIMTSLTSGIITLARERTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYYPERTDLLRALARHVHDLSNAAIERADPTSGPVDAALRRVVESQLDLGPIVLFVYYEPSILADPELAAYFDIGDEAIVEVLNRASYPPGWARRVFWALMQAGYEAAKDGMPRHQIVDAIMTSLTSGIITL Hydrogen bonds contact Hydrophobic contact | ||||
| 48 | BUB1 mitotic checkpoint serine/threonine kinase (BUB1) | 6F7B | 8.36 | |
Target general information Gen name BUB1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms hBUB1; Mitotic checkpoint serine/threonine-protein kinase BUB1; BUB1L; BUB1A Protein family Protein kinase superfamily, Ser/Thr protein kinase family, BUB1 subfamily Biochemical class Kinase Function Has a key role in the assembly of checkpoint proteins at the kinetochore, being required for the subsequent localization of CENPF, BUB1B, CENPE and MAD2L1. Required for the kinetochore localization of PLK1. Required for centromeric enrichment of AUKRB in prometaphase. Plays an important role in defining SGO1 localization and thereby affects sister chromatid cohesion. Acts as a substrate for anaphase-promoting complex or cyclosome (APC/C) in complex with its activator CDH1 (APC/C-Cdh1). Necessary for ensuring proper chromosome segregation and binding to BUB3 is essential for this function. Can regulate chromosome segregation in a kinetochore-independent manner. Can phosphorylate BUB3. The BUB1-BUB3 complex plays a role in the inhibition of APC/C when spindle-assembly checkpoint is activated and inhibits the ubiquitin ligase activity of APC/C by phosphorylating its activator CDC20. This complex can also phosphorylate MAD1L1. Kinase activity is essential for inhibition of APC/CCDC20 and for chromosome alignment but does not play a major role in the spindle-assembly checkpoint activity. Mediates cell death in response to chromosome missegregation and acts to suppress spontaneous tumorigenesis. Serine/threonine-protein kinase that performs 2 crucial functions during mitosis: it is essential for spindle-assembly checkpoint signaling and for correct chromosome alignment. Related diseases Microcephaly 30, primary, autosomal recessive (MCPH30) [MIM:620183]: A form of microcephaly, a disease defined as a head circumference more than 3 standard deviations below the age, sex and ethnically matched mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. MCPH30 is characterized by small head, poor overall growth, and global developmental delay with variably impaired intellectual development. Affected individuals may also have variable congenital anomalies, including atrial septal defect, dysmorphic facial features, tracheal stenosis, and anomalies of the skin and teeth. {ECO:0000269|PubMed:35044816}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) NA Interacts with O95376; O60566; O43684; P46108; Q8NG31; Q8NG31-2; Q9GZQ8; P03070 EC number EC 2.7.11.1 Uniprot keywords 3D-structure; Alternative splicing; Apoptosis; ATP-binding; Cell cycle; Cell division; Centromere; Chromosome; Chromosome partition; Host-virus interaction; Intellectual disability; Kinase; Kinetochore; Mitosis; Nucleotide-binding; Nucleus; Phosphoprotein; Primary microcephaly; Proteomics identification; Reference proteome; Serine/threonine-protein kinase; Transferase; Ubl conjugation Protein physicochemical properties Chain ID A Molecular weight (Da) 39564.8 Length 343 Aromaticity 0.12 Instability index 31.17 Isoelectric point 8.49 Charge (pH=7) 4.7 3D Binding mode Sequence APNFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEFQLGSKLVYVHHLLGEGAFAQVYEATQKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETXGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS Hydrogen bonds contact Hydrophobic contact | ||||
| 49 | Glucocorticoid receptor (NR3C1) | 4UDD | 8.35 | |
Target general information Gen name NR3C1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms Nuclear receptor subfamily 3 group C member 1; GRL; GR Protein family Nuclear hormone receptor family, NR3 subfamily Biochemical class Nuclear hormone receptor Function Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth (By similarity). Related diseases Glucocorticoid resistance, generalized (GCCR) [MIM:615962]: An autosomal dominant disease characterized by increased plasma cortisol concentration and high urinary free cortisol, resistance to adrenal suppression by dexamethasone, and the absence of Cushing syndrome typical signs. Clinical features include hypoglycemia, hypertension, metabolic alkalosis, chronic fatigue and profound anxiety. {ECO:0000269|PubMed:11589680, ECO:0000269|PubMed:11701741, ECO:0000269|PubMed:12050230, ECO:0000269|PubMed:15769988, ECO:0000269|PubMed:1704018, ECO:0000269|PubMed:17635946, ECO:0000269|PubMed:20335448, ECO:0000269|PubMed:21362280, ECO:0000269|PubMed:23426617, ECO:0000269|PubMed:24483153, ECO:0000269|PubMed:26031419, ECO:0000269|PubMed:26541474, ECO:0000269|PubMed:27120390, ECO:0000269|PubMed:7683692}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB00240; DB04630; DB00288; DB00394; DB00443; DB14669; DB01222; DB01410; DB01013; DB13158; DB00838; DB01380; DB13003; DB11921; DB01260; DB00547; DB01234; DB14649; DB00223; DB09095; DB06781; DB01395; DB00687; DB00663; DB00180; DB00591; DB01047; DB00324; DB01185; DB00846; DB13867; DB08906; DB00588; DB11619; DB02210; DB00769; DB00741; DB14538; DB14539; DB14540; DB14541; DB14542; DB14543; DB14544; DB00367; DB14596; DB00253; DB00351; DB00959; DB00834; DB00764; DB14512; DB00717; DB12637; DB05423; DB01384; DB01130; DB00860; DB15566; DB14631; DB00635; DB00396; DB00896; DB14583; DB00421; DB09091; DB00620; DB08867; DB00596; DB15114 Interacts with P31749; P01730; P00533; P41235; P07900; Q6ZU52; P06239; P28702; Q14141; O95416; P82094; P59598; Q62667; Q61026 EC number NA Uniprot keywords 3D-structure; Acetylation; Alternative initiation; Alternative splicing; Apoptosis; Cell cycle; Cell division; Chromatin regulator; Chromosome; Chromosome partition; Cytoplasm; Cytoskeleton; Disease variant; DNA-binding; Isopeptide bond; Lipid-binding; Metal-binding; Methylation; Mitochondrion; Mitosis; Nucleus; Phosphoprotein; Proteomics identification; Pseudohermaphroditism; Receptor; Reference proteome; RNA-binding; Steroid-binding; Transcription; Transcription regulation; Ubl conjugation; Zinc; Zinc-finger Protein physicochemical properties Chain ID A Molecular weight (Da) 30565.2 Length 262 Aromaticity 0.1 Instability index 46.97 Isoelectric point 5.79 Charge (pH=7) -4.17 3D Binding mode Sequence TPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQMIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQKENALLRYLLDKDD Hydrogen bonds contact Hydrophobic contact | ||||
| 50 | Fumarate reductase flavoprotein subunit | 1Y0P | 8.34 | |
Target general information Gen name fccA Organism Shewanella frigidimarina Uniprot ID TTD ID NA Synonyms fcc3 Protein family FAD-dependent oxidoreductase 2 family, FRD/SDH subfamily Biochemical class Oxidoreductase Function Electron carrier activity.Fumarate reductase (menaquinone).Metal ion binding.Nucleic acid binding.Succinate dehydrogenase activity. Related diseases Pigmentary disorder, reticulate, with systemic manifestations, X-linked (PDR) [MIM:301220]: An X-linked recessive disorder characterized by recurrent infections and sterile inflammation in various organs. Diffuse skin hyperpigmentation with a distinctive reticulate pattern is universally evident by early childhood. This is later followed in many patients by hypohidrosis, corneal inflammation and scarring, enterocolitis that resembles inflammatory bowel disease, and recurrent urethral strictures. Melanin and amyloid deposition is present in the dermis. Affected males also have a characteristic facies with frontally upswept hair and flared eyebrows. Female carriers have only restricted pigmentary changes along Blaschko's lines. {ECO:0000269|PubMed:27019227}. The disease is caused by variants affecting the gene represented in this entry. XLPDR is caused by a recurrent intronic mutation that results in missplicing and reduced POLA1 expression. This leads to a decrease in cytosolic RNA:DNA hybrids and constitutive activation of type I interferon responses, but has no effect on cell replication. {ECO:0000269|PubMed:27019227}.; DISEASE: Van Esch-O'Driscoll syndrome (VEODS) [MIM:301030]: An X-linked recessive syndrome characterized by different degrees of intellectual disability, moderate to severe short stature, microcephaly, hypogonadism, and variable congenital malformations. {ECO:0000269|PubMed:31006512}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB04734; DB03147; DB01677; DB03343 Interacts with NA EC number 1.3.2.4 Uniprot keywords 3D-structure; Electron transport; FAD; Flavoprotein; Heme; Iron; Metal-binding; Oxidoreductase; Periplasm; Transport Protein physicochemical properties Chain ID A Molecular weight (Da) 60177.2 Length 568 Aromaticity 0.06 Instability index 27.7 Isoelectric point 6 Charge (pH=7) -8.64 3D Binding mode Sequence ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS Hydrogen bonds contact Hydrophobic contact | ||||
| 51 | Glucagon-like peptide 1 receptor (GLP1R) | 6X1A | 8.34 | |
Target general information Gen name GLP1R Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms GLP-1R; GLP-1-R; GLP-1 receptor Protein family G-protein coupled receptor 2 family Biochemical class GPCR secretin Function Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Related diseases Lynch syndrome 2 (LYNCH2) [MIM:609310]: A form of Lynch syndrome, an autosomal dominant disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early-onset colorectal carcinoma (CRC) and extra-colonic tumors of the gastrointestinal, urological and female reproductive tracts. Lynch syndrome is reported to be the most common form of inherited colorectal cancer in the Western world. Clinically, it is often divided into two subgroups. Type I is characterized by hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II is characterized by increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical Lynch syndrome is based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term 'suspected Lynch syndrome' or 'incomplete Lynch syndrome' can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected. {ECO:0000269|PubMed:10323887, ECO:0000269|PubMed:10375096, ECO:0000269|PubMed:10386556, ECO:0000269|PubMed:10413423, ECO:0000269|PubMed:10480359, ECO:0000269|PubMed:10598809, ECO:0000269|PubMed:10627141, ECO:0000269|PubMed:10660333, ECO:0000269|PubMed:10671064, ECO:0000269|PubMed:10713887, ECO:0000269|PubMed:10777691, ECO:0000269|PubMed:10882759, ECO:0000269|PubMed:11139242, ECO:0000269|PubMed:11427529, ECO:0000269|PubMed:11726306, ECO:0000269|PubMed:11748856, ECO:0000269|PubMed:11754112, ECO:0000269|PubMed:11781295, ECO:0000269|PubMed:11793442, ECO:0000269|PubMed:11839723, ECO:0000269|PubMed:11870161, ECO:0000269|PubMed:12095971, ECO:0000269|PubMed:12132870, ECO:0000269|PubMed:12200596, ECO:0000269|PubMed:12362047, ECO:0000269|PubMed:12373605, ECO:0000269|PubMed:12655562, ECO:0000269|PubMed:12658575, ECO:0000269|PubMed:14635101, ECO:0000269|PubMed:14961575, ECO:0000269|PubMed:15064764, ECO:0000269|PubMed:15139004, ECO:0000269|PubMed:15365995, ECO:0000269|PubMed:15365996, ECO:0000269|PubMed:16083711, ECO:0000269|PubMed:16451135, ECO:0000269|PubMed:17301300, ECO:0000269|PubMed:17510385, ECO:0000269|PubMed:18561205, ECO:0000269|PubMed:20020535, ECO:0000269|PubMed:21120944, ECO:0000269|PubMed:22753075, ECO:0000269|PubMed:7757073, ECO:0000269|PubMed:8566964, ECO:0000269|PubMed:8571956, ECO:0000269|PubMed:8574961, ECO:0000269|PubMed:8797773, ECO:0000269|PubMed:8872463, ECO:0000269|PubMed:8993976, ECO:0000269|PubMed:9048925, ECO:0000269|PubMed:9067757, ECO:0000269|PubMed:9218993, ECO:0000269|PubMed:9272156, ECO:0000269|PubMed:9298827, ECO:0000269|PubMed:9311737, ECO:0000269|PubMed:9326924, ECO:0000269|PubMed:9399661, ECO:0000269|PubMed:9559627, ECO:0000269|PubMed:9718327, ECO:0000269|PubMed:9833759, ECO:0000269|PubMed:9927034, ECO:0000269|Ref.5}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Mismatch repair cancer syndrome 1 (MMRCS1) [MIM:276300]: An autosomal recessive form of mismatch repair cancer syndrome, a childhood cancer predisposition syndrome encompassing a broad tumor spectrum. This includes hematological malignancies, central nervous system tumors, Lynch syndrome-associated malignancies such as colorectal tumors as well as multiple intestinal polyps, embryonic tumors and rhabdomyosarcoma. Multiple cafe-au-lait macules, a feature reminiscent of neurofibromatosis type 1, are often found as first manifestation of the underlying cancer. {ECO:0000269|PubMed:11427529, ECO:0000269|PubMed:17440981, ECO:0000269|PubMed:7661930}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Muir-Torre syndrome (MRTES) [MIM:158320]: Rare autosomal dominant disorder characterized by sebaceous neoplasms and visceral malignancy. {ECO:0000269|PubMed:8751876}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Defects in MLH1 may contribute to lobular carcinoma in situ (LCIS), a non-invasive neoplastic disease of the breast.; DISEASE: Endometrial cancer (ENDMC) [MIM:608089]: A malignancy of endometrium, the mucous lining of the uterus. Most endometrial cancers are adenocarcinomas, cancers that begin in cells that make and release mucus and other fluids. Disease susceptibility is associated with variants affecting the gene represented in this entry.; DISEASE: Some epigenetic changes can be transmitted unchanged through the germline (termed 'epigenetic inheritance'). Evidence that this mechanism occurs in humans is provided by the identification of individuals in whom 1 allele of the MLH1 gene is epigenetically silenced throughout the soma (implying a germline event). These individuals are affected by Lynch syndrome but does not have identifiable mutations in MLH1, even though it is silenced, which demonstrates that an epimutation can phenocopy a genetic disease.; DISEASE: Colorectal cancer (CRC) [MIM:114500]: A complex disease characterized by malignant lesions arising from the inner wall of the large intestine (the colon) and the rectum. Genetic alterations are often associated with progression from premalignant lesion (adenoma) to invasive adenocarcinoma. Risk factors for cancer of the colon and rectum include colon polyps, long-standing ulcerative colitis, and genetic family history. {ECO:0000269|PubMed:10598809, ECO:0000269|PubMed:10882759, ECO:0000269|PubMed:12132870, ECO:0000269|PubMed:12655564, ECO:0000269|PubMed:14504054, ECO:0000269|PubMed:15184898, ECO:0000269|PubMed:18033691, ECO:0000269|PubMed:8872463, ECO:0000269|PubMed:9032648, ECO:0000269|PubMed:9087566, ECO:0000269|PubMed:9611074}. Disease susceptibility is associated with variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB09043; DB09045; DB15650; DB01276; DB00040; DB16697; DB06655; DB09265; DB13928; DB14027; DB15171 Interacts with A8MQ03; Q07627; Q8IUG1; P60409; P60410; P60411; Q9BYP8; P26371; Q7Z3S9; P0DPK4 EC number NA Uniprot keywords 3D-structure; ADP-ribosylation; Cell membrane; Disulfide bond; G-protein coupled receptor; Glycoprotein; Membrane; Receptor; Reference proteome; Signal; Transducer; Transmembrane; Transmembrane helix Protein physicochemical properties Chain ID R Molecular weight (Da) 45579.6 Length 390 Aromaticity 0.16 Instability index 39.66 Isoelectric point 6.73 Charge (pH=7) -0.68 3D Binding mode Sequence ATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVFSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERWRLE Hydrogen bonds contact Hydrophobic contact | ||||
| 52 | Pyruvate dehydrogenase [ubiquinone] | 3EYA | 8.33 | |
Target general information Gen name poxB Organism Escherichia coli (strain K12) Uniprot ID TTD ID NA Synonyms b0871;JW0855 Protein family TPP enzyme family Biochemical class Oxidoreductase Function Flavin adenine dinucleotide binding.Identical protein binding.Lipid binding.Magnesium ion binding.Pyruvate dehydrogenase (quinone) activity.Thiamine pyrophosphate binding. Related diseases Glycogen storage disease 6 (GSD6) [MIM:232700]: A metabolic disorder characterized by mild to moderate hypoglycemia, mild ketosis, growth retardation, and prominent hepatomegaly. Heart and skeletal muscle are not affected. {ECO:0000269|PubMed:9529348}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) NA Interacts with P07003 EC number 1.2.5.1 Uniprot keywords 3D-structure; Cell inner membrane; Cell membrane; Direct protein sequencing; FAD; Flavoprotein; Lipid-binding; Magnesium; Membrane; Metal-binding; Nucleotide-binding; Oxidoreductase; Pyruvate; Reference proteome; Thiamine pyrophosphate; Ubiquinone Protein physicochemical properties Chain ID A,B,C,D,E,F,G,H,I,J,K,L Molecular weight (Da) 113027 Length 1046 Aromaticity 0.07 Instability index 35.99 Isoelectric point 5.75 Charge (pH=7) -24.38 3D Binding mode Sequence MKQTVAAYIAKTLESAGVKRIWGVTGDSLNGLSDSLNRMGTIEWMSTRHEEVAAFAAGAEAQLSGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQELFRECSHYCELVSSPEQIPQVLAIAMRKAVLNRGVSVVVLPGDVALKPAPEGATMHWYHAPQPVVTPEEEELRKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKIKAPIVHALRGKEHVEYDNPYDVGMTGLIGFSSGFHTMMNADTLVLLGTQFPYRAFYPTDAKIIQIDINPASIGAHSKVDMALVGDIKSTLRALLPLVEEKADRKFLDKALEDYRDARKGLDDLAKPSEKAIHPQYLAQQISHFAADDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAQATEPERQVVAMCGDGGFSMLMGDFLSVVQMKLPVKIVVFNNSVLGFDGTELHDTNFARIAEACGITGIRVEKASEVDEALQRAFSIDGPVLVDVVVAKEELAIPMKQTVAAYIAKTLESAGVKRIWGVTGDSLNGLSDSLNRMGTIEWMSTRHEEVAAFAAGAEAQLSGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQELFRECSHYCELVSSPEQIPQVLAIAMRKAVLNRGVSVVVLPGDVALKPAPEGATMHWYHAPQPVVTPEEEELRKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKIKAPIVHALRGKEHVEYDNPYDVGMTGLIGFSSGFHTMMNADTLVLLGTQFPYRAFYPTDAKIIQIDINPASIGAHSKVDMALVGDIKSTLRALLPLVEEKADRKFLDKALEDYRDARKGLDDLAKPSEKAIHPQYLAQQISHFAADDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAQATEPERQVVAMCGDGGFSMLMGDFLSVVQMKLPVKIVVFNNSVLGFVGTELHDTNFARIAEACGITGIRVEKASEVDEALQRAFSIDGPVLVDVVVAKEELAIP Hydrogen bonds contact Hydrophobic contact | ||||
| 53 | Opioid receptor sigma 1 (OPRS1) | 6DJZ | 8.33 | |
Target general information Gen name SIGMAR1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms hSigmaR1; Sigma1R; Sigma1-receptor; Sigma non-opioid intracellular receptor 1; Sigma 1-type opioid receptor; SRBP; SR31747-binding protein; SR31747 binding protein 1; SR-BP; SIG-1R; Opioid receptor, s Protein family ERG2 family Biochemical class GPCR rhodopsin Function Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration. Necessary for proper mitochondrial axonal transport in motor neurons, in particular the retrograde movement of mitochondria. Plays a role in protecting cells against oxidative stress-induced cell death via its interaction with RNF112. Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. Related diseases Amyotrophic lateral sclerosis 16, juvenile (ALS16) [MIM:614373]: A neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases. {ECO:0000269|PubMed:21842496}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Neuronopathy, distal hereditary motor, autosomal recessive 2 (HMNR2) [MIM:605726]: A form of distal hereditary motor neuronopathy, a heterogeneous group of neuromuscular disorders caused by selective degeneration of motor neurons in the anterior horn of the spinal cord, without sensory deficit in the posterior horn. The overall clinical picture consists of a classical distal muscular atrophy syndrome in the legs without clinical sensory loss. The disease starts with weakness and wasting of distal muscles of the anterior tibial and peroneal compartments of the legs. Later on, weakness and atrophy may expand to the proximal muscles of the lower limbs and/or to the distal upper limbs. HMNR2 is characterized by onset of distal muscle weakness and wasting affecting the lower and upper limbs in the first decade. {ECO:0000269|PubMed:26078401, ECO:0000269|PubMed:27629094}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB00321; DB09014; DB00907; DB00514; DB01488; DB00574; DB00502; DB00956; DB00704; DB00540; DB06174; DB00652; DB11186; DB03575; DB05316; DB01708; DB00409; DB01104 Interacts with Q92847-1; Q99720-1; O00213-2; P17612; P50454; P37173 EC number NA Uniprot keywords 3D-structure; Alternative splicing; Amyotrophic lateral sclerosis; Cell junction; Cell membrane; Cell projection; Cytoplasmic vesicle; Direct protein sequencing; Disease variant; Endoplasmic reticulum; Lipid droplet; Lipid transport; Membrane; Neurodegeneration; Neuropathy; Nucleus; Postsynaptic cell membrane; Proteomics identification; Receptor; Reference proteome; Synapse; Transmembrane; Transmembrane helix; Transport Protein physicochemical properties Chain ID A Molecular weight (Da) 23901 Length 212 Aromaticity 0.14 Instability index 33.12 Isoelectric point 5.61 Charge (pH=7) -5.6 3D Binding mode Sequence RWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLF Hydrogen bonds contact Hydrophobic contact | ||||
| 54 | Cytochrome P450 1B1 (CYP1B1) | 3PM0 | 8.33 | |
Target general information Gen name CYP1B1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms CYPIB1 Protein family Cytochrome P450 family Biochemical class Paired donor oxygen oxidoreductase Function In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, retinoid and xenobiotics. Preferentially oxidizes 17beta-estradiol to the carcinogenic 4-hydroxy derivative, and a variety of procarcinogenic compounds to their activated forms, including polycyclic aromatic hydrocarbons. Promotes angiogenesis by removing cellular oxygenation products, thereby decreasing oxidative stress, release of antiangiogenic factor THBS2, then allowing endothelial cells migration, cell adhesion and capillary morphogenesis. These changes are concommitant with the endothelial nitric oxide synthase activity and nitric oxide synthesis. Plays an important role in the regulation of perivascular cell proliferation, migration, and survival through modulation of the intracellular oxidative state and NF-kappa-B expression and/or activity, during angiogenesis. Contributes to oxidative homeostasis and ultrastructural organization and function of trabecular meshwork tissue through modulation of POSTN expression. Cytochromes P450 are a group of heme-thiolate monooxygenases. Related diseases Anterior segment dysgenesis 6 (ASGD6) [MIM:617315]: A form of anterior segment dysgenesis, a group of defects affecting anterior structures of the eye including cornea, iris, lens, trabecular meshwork, and Schlemm canal. Anterior segment dysgeneses result from abnormal migration or differentiation of the neural crest derived mesenchymal cells that give rise to components of the anterior chamber during eye development. Different anterior segment anomalies may exist alone or in combination, including iris hypoplasia, enlarged or reduced corneal diameter, corneal vascularization and opacity, posterior embryotoxon, corectopia, polycoria, abnormal iridocorneal angle, ectopia lentis, and anterior synechiae between the iris and posterior corneal surface. Clinical conditions falling within the phenotypic spectrum of anterior segment dysgeneses include aniridia, Axenfeld anomaly, Reiger anomaly/syndrome, Peters anomaly, and iridogoniodysgenesis. ASGD6 patients predominantly manifest Peters anomaly. Peters anomaly consists of corneal leukoma, defects in the posterior structures of the cornea such as absence of the posterior corneal stroma and Descemet membrane, and a variable degree of iridocorneal and/or keratolenticular adhesions. Over 50% of patients develop glaucoma in childhood. {ECO:0000269|PubMed:11403040}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Glaucoma 3, primary congenital, A (GLC3A) [MIM:231300]: An autosomal recessive form of primary congenital glaucoma (PCG). PCG is characterized by marked increase of intraocular pressure at birth or early childhood, large ocular globes (buphthalmos) and corneal edema. It results from developmental defects of the trabecular meshwork and anterior chamber angle of the eye that prevent adequate drainage of aqueous humor. {ECO:0000269|PubMed:10227395, ECO:0000269|PubMed:10655546, ECO:0000269|PubMed:11184479, ECO:0000269|PubMed:11527932, ECO:0000269|PubMed:11774072, ECO:0000269|PubMed:11980847, ECO:0000269|PubMed:12036985, ECO:0000269|PubMed:12525557, ECO:0000269|PubMed:14635112, ECO:0000269|PubMed:14640114, ECO:0000269|PubMed:15255109, ECO:0000269|PubMed:15342693, ECO:0000269|PubMed:15475877, ECO:0000269|PubMed:16490498, ECO:0000269|PubMed:16688110, ECO:0000269|PubMed:16735994, ECO:0000269|PubMed:16862072, ECO:0000269|PubMed:18470941, ECO:0000269|PubMed:9463332, ECO:0000269|PubMed:9497261}. The disease is caused by variants affecting distinct genetic loci, including the gene represented in this entry.; DISEASE: Glaucoma 1, open angle, A (GLC1A) [MIM:137750]: A form of primary open angle glaucoma (POAG). POAG is characterized by a specific pattern of optic nerve and visual field defects. The angle of the anterior chamber of the eye is open, and usually the intraocular pressure is increased. However, glaucoma can occur at any intraocular pressure. The disease is generally asymptomatic until the late stages, by which time significant and irreversible optic nerve damage has already taken place. {ECO:0000269|PubMed:11774072}. The gene represented in this entry acts as a disease modifier. Digenic mutations in CYP1B1 and MYOC have been found in a family segregating both primary adult-onset and juvenile forms of open angle glaucoma (PubMed:11774072). All affected family members with mutations in both MYOC and CYP1B1 had juvenile glaucoma, whereas those with only the MYOC mutation had the adult-onset form (PubMed:11774072). {ECO:0000269|PubMed:11774072}. Drugs (DrugBank ID) DB02342; DB00613; DB06732; DB00443; DB00121; DB01222; DB00201; DB09061; DB14737; DB01254; DB00694; DB01248; DB00997; DB00470; DB00530; DB00783; DB13952; DB13953; DB13954; DB13955; DB13956; DB00655; DB07776; DB00499; DB01645; DB01381; DB00741; DB01064; DB01026; DB00448; DB14009; DB01065; DB00170; DB00959; DB01204; DB14011; DB03467; DB00338; DB01229; DB14631; DB00635; DB01087; DB00396; DB00818; DB04216; DB02709; DB00675; DB00624; DB13946; DB00277; DB12245; DB11155 Interacts with Q02763 EC number EC 1.14.14.- Uniprot keywords 3D-structure; Disease variant; Endoplasmic reticulum; Fatty acid metabolism; Glaucoma; Heme; Iron; Lipid metabolism; Lyase; Membrane; Metal-binding; Microsome; Mitochondrion; Monooxygenase; Oxidoreductase; Peters anomaly; Proteomics identification; Reference proteome; Steroid metabolism Protein physicochemical properties Chain ID A Molecular weight (Da) 51875.9 Length 459 Aromaticity 0.1 Instability index 34.16 Isoelectric point 8.64 Charge (pH=7) 4.89 3D Binding mode Sequence QAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPSFASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSAEKKAAGDGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAELDQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVVFVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLD Hydrogen bonds contact Hydrophobic contact | ||||
| 55 | Serine/threonine-protein kinase WNK1 (WNK1) | 5WE8 | 8.32 | |
Target general information Gen name WNK1 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms p65; hWNK1; Protein kinase with no lysine 1; Protein kinase lysine-deficient 1; Kinase deficient protein; KDP; HSN2; Erythrocyte 65 kDa protein Protein family Protein kinase superfamily, Ser/Thr protein kinase family, WNK subfamily Biochemical class NA Function Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4, SLC26A6 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition (By similarity). Related diseases Pseudohypoaldosteronism 2C (PHA2C) [MIM:614492]: An autosomal dominant disorder characterized by severe hypertension, hyperkalemia, hyperchloremia, mild hyperchloremic metabolic acidosis in some cases, and correction of physiologic abnormalities by thiazide diuretics. {ECO:0000269|PubMed:11498583}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Neuropathy, hereditary sensory and autonomic, 2A (HSAN2A) [MIM:201300]: A form of hereditary sensory and autonomic neuropathy, a genetically and clinically heterogeneous group of disorders characterized by degeneration of dorsal root and autonomic ganglion cells, and by sensory and/or autonomic abnormalities. HSAN2A is an autosomal recessive disorder characterized by impairment of pain, temperature and touch sensation, onset of symptoms in infancy or early childhood, occurrence of distal extremity pathologies (paronychia, whitlows, ulcers, and Charcot joints), frequent amputations, sensory loss that affects all modalities of sensation (lower and upper limbs and perhaps the trunk as well), absence or diminution of tendon reflexes (usually in all limbs), minimal autonomic dysfunction, absence of sensory nerve action potentials, and virtual absence of myelinated fibers with decreased numbers of unmyelinated fibers in sural nerves. {ECO:0000269|PubMed:15060842, ECO:0000269|PubMed:15911806, ECO:0000269|PubMed:18521183}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) NA Interacts with O95747; P62136; P31947; P62258; P61981; P63104; P29101 EC number EC 2.7.11.1 Uniprot keywords 3D-structure; Alternative promoter usage; Alternative splicing; ATP-binding; Chloride; Cytoplasm; Cytoskeleton; Direct protein sequencing; Glycoprotein; Kinase; Neurodegeneration; Neuropathy; Nucleotide-binding; Nucleus; Phosphoprotein; Proteomics identification; Reference proteome; Serine/threonine-protein kinase; Transferase; Ubl conjugation Protein physicochemical properties Chain ID A,B Molecular weight (Da) 61906 Length 542 Aromaticity 0.1 Instability index 41.99 Isoelectric point 8.64 Charge (pH=7) 8.04 3D Binding mode Sequence TKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRADFAKSVIGTPEFMAPEMYAAAYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETLETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRADFAKSVIGTPEFMAPEMYAAAYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ Hydrogen bonds contact Hydrophobic contact | ||||
| 56 | Debrisoquine 4-hydroxylase (CYP2D6) | 4WNV | 8.32 | |
Target general information Gen name CYP2D6 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms P450-DB1; Cytochrome P450-DB1; Cytochrome P450 2D6; CYPIID6; CYP2DL1 Protein family Cytochrome P450 family Biochemical class Paired donor oxygen oxidoreductase Function It is involved in the metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants. Responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. Related diseases A chromosomal aberration involving BCL2 has been found in chronic lymphatic leukemia. Translocation t(14;18)(q32;q21) with immunoglobulin gene regions. BCL2 mutations found in non-Hodgkin lymphomas carrying the chromosomal translocation could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions. {ECO:0000269|PubMed:2875799, ECO:0000269|PubMed:3285301}. Drugs (DrugBank ID) DB01562; DB01472; DB14010; DB12001; DB05812; DB01193; DB00316; DB15568; DB00918; DB06203; DB00866; DB01424; DB01118; DB00321; DB00381; DB00613; DB00543; DB00182; DB00701; DB11785; DB01435; DB01429; DB01274; DB01238; DB14185; DB09204; DB11638; DB06216; DB00637; DB11586; DB00335; DB00289; DB01076; DB00972; DB04957; DB09013; DB16703; DB01086; DB06770; DB01244; DB15982; DB00195; DB01295; DB12236; DB01128; DB04889; DB00810; DB13975; DB08807; DB00188; DB09128; DB12151; DB12752; DB06726; DB00297; DB08808; DB00921; DB01156; DB00490; DB09173; DB00201; DB09061; DB14737; DB06016; DB00521; DB01136; DB00482; DB04846; DB00439; DB00185; DB00608; DB01114; DB00477; DB00356; DB01410; DB01166; DB00501; DB01012; DB00568; DB00604; DB00215; DB12499; DB00283; DB04920; DB14025; DB00349; DB00845; DB01242; DB00575; DB13508; DB00257; DB00363; DB09065; DB05239; DB00907; DB00318; DB11672; DB14635; DB00924; DB00091; DB11963; DB06292; DB04884; DB00496; DB01264; DB09183; DB04840; DB00705; DB06512; DB01151; DB06700; DB16650; DB12161; DB13679; DB09555; DB01191; DB00633; DB01576; DB00514; DB00647; DB11994; DB01551; DB00343; DB01093; DB01075; DB00757; DB01184; DB00843; DB09167; DB00590; DB01142; DB00997; DB00470; DB04855; DB00476; DB00625; DB11979; DB00216; DB15444; DB09039; DB13874; DB01228; DB06735; DB11718; DB00494; DB13757; DB00751; DB00530; DB13443; DB01175; DB06678; DB00187; DB00330; DB01466; DB01628; DB01590; DB12500; DB01023; DB00574; DB06702; DB12265; DB01195; DB04841; DB00472; DB00623; DB01095; DB00176; DB00983; DB02703; DB15149; DB00674; DB05087; DB00317; DB08909; DB00986; DB01218; DB00502; DB00956; DB01611; DB00557; DB09053; DB01177; DB04946; DB00619; DB00458; DB08952; DB00224; DB06370; DB13293; DB04818; DB16200; DB11633; DB06636; DB00951; DB11757; DB00602; DB09570; DB01026; DB00598; DB12212; DB00448; DB11732; DB16217; DB09078; DB00528; DB12070; DB09351; DB01210; DB08918; DB00281; DB04948; DB01206; DB00836; DB01601; DB00455; DB04871; DB09195; DB06708; DB04829; DB09238; DB00934; DB14921; DB00737; DB14009; DB09224; DB00170; DB00454; DB00532; DB13530; DB06691; DB01071; DB00933; DB01577; DB00333; DB00763; DB01403; DB01028; DB09241; DB01214; DB01233; DB00264; DB00379; DB06148; DB01388; DB01110; DB00211; DB01454; DB06595; DB00834; DB00805; DB08893; DB00370; DB12523; DB01171; DB00745; DB14011; DB09049; DB00731; DB04861; DB01149; DB00220; DB09048; DB00238; DB00627; DB00622; DB00699; DB02701; DB00184; DB01115; DB04868; DB12005; DB00540; DB00334; DB14881; DB00338; DB00904; DB11130; DB04911; DB01173; DB11837; DB04938; DB01096; DB01580; DB01062; DB00497; DB06412; DB01192; DB01267; DB00377; DB06603; DB00715; DB06589; DB00022; DB01359; DB00738; DB01074; DB08922; DB00850; DB03783; DB00780; DB00914; DB00252; DB05316; DB01100; DB00960; DB00592; DB01621; DB04951; DB17472; DB11642; DB08901; DB01297; DB15822; DB01087; DB01035; DB00433; DB00396; DB01131; DB00420; DB01069; DB09288; DB01182; DB00571; DB04216; DB01224; DB00908; DB00468; DB01129; DB00863; DB00243; DB00234; DB14761; DB00409; DB06506; DB02709; DB11855; DB13174; DB11753; DB08864; DB14840; DB00734; DB12693; DB00503; DB00953; DB09291; DB15119; DB00412; DB05271; DB12332; DB11614; DB06654; DB01232; DB01037; DB06144; DB01104; DB00203; DB00641; DB01591; DB00398; DB12713; DB00489; DB06727; DB01323; DB09118; DB06820; DB06729; DB06608; DB11770; DB00675; DB00706; DB06204; DB06083; DB01079; DB12095; DB06287; DB00857; DB00342; DB13775; DB04905; DB04844; DB11712; DB00277; DB00679; DB01623; DB00208; DB00373; DB01409; DB00932; DB06137; DB01036; DB05109; DB00193; DB00752; DB00656; DB12245; DB00726; DB00792; DB00209; DB15328; DB09076; DB13609; DB15091; DB11915; DB00862; DB08881; DB00285; DB00661; DB06217; DB06684; DB09185; DB00570; DB00361; DB11739; DB09068; DB01392; DB00549; DB15688; DB00425; DB01624 Interacts with NA EC number EC 1.14.14.- Uniprot keywords 3D-structure; Alternative splicing; Cholesterol metabolism; Endoplasmic reticulum; Fatty acid metabolism; Heme; Iron; Lipid metabolism; Membrane; Metal-binding; Microsome; Monooxygenase; Oxidoreductase; Proteomics identification; Reference proteome; Steroid metabolism; Sterol metabolism Protein physicochemical properties Chain ID A Molecular weight (Da) 51898.1 Length 464 Aromaticity 0.09 Instability index 43.83 Isoelectric point 6.76 Charge (pH=7) -0.99 3D Binding mode Sequence GKLPPGPLPLPGLGNLLFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR Hydrogen bonds contact Hydrophobic contact | ||||
| 57 | Caspase-7 (CASP7) | 1SHJ | 8.32 | |
Target general information Gen name CASP7 Organism Homo sapiens (Human) Uniprot ID TTD ID Synonyms MCH3; ICE-like apoptotic protease 3; ICE-LAP3; CMH-1; CASP-7; Apoptotic protease Mch-3 Protein family Peptidase C14A family Biochemical class Peptidase Function Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death. Involved in the activation cascade of caspases responsible for apoptosis execution. Related diseases Pregnancy loss, recurrent, 3 (RPRGL3) [MIM:614391]: A common complication of pregnancy, resulting in spontaneous abortion before the fetus has reached viability. The term includes all miscarriages from the time of conception until 24 weeks of gestation. Recurrent pregnancy loss is defined as 3 or more consecutive spontaneous abortions. {ECO:0000269|PubMed:17339269}. Disease susceptibility is associated with variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB05408; DB03384; DB06255 Interacts with Q13490; P83105; P42858; Q8N4N3-2; P43364; Q16236; Q9GZT8; Q13177; P27986-2; P21673; Q86WV1-2; P17405; P98170 EC number EC 3.4.22.60 Uniprot keywords 3D-structure; Acetylation; Allosteric enzyme; Alternative splicing; Apoptosis; Cytoplasm; Hydrolase; Nucleus; Phosphoprotein; Protease; Proteomics identification; Reference proteome; RNA-binding; Secreted; Thiol protease; Ubl conjugation; Zymogen Protein physicochemical properties Chain ID A,B Molecular weight (Da) 47441.5 Length 417 Aromaticity 0.11 Instability index 20.98 Isoelectric point 8.38 Charge (pH=7) 6.12 3D Binding mode Sequence TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGARCKTLLEKPKLFFIQACRGTEPRYKIPVEADFLFAYSTVRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFKKQIPCVVSMLTKELYFSQVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGARCKTLLEKPKLFFIQACRGPRYKIPVEADFLFAYSTVPGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESKQIPCVVSMLTKELYFSQ Hydrogen bonds contact Hydrophobic contact | ||||
| 58 | Glutathione S-transferase kappa 1 | 3RPN | 8.31 | |
Target general information Gen name GSTK1 Organism Homo sapiens (Human) Uniprot ID TTD ID NA Synonyms HDCMD47P Protein family GST superfamily, Kappa family Biochemical class Transferase / transferase inhibitor Function Glutathione peroxidase activity.Glutathione transferase activity.Protein disulfide oxidoreductase activity.Receptor binding. Related diseases Dyskinesia, limb and orofacial, infantile-onset (IOLOD) [MIM:616921]: An autosomal recessive, early-onset hyperkinetic movement disorder characterized by axial hypotonia, dyskinesia of the limbs and trunk, orofacial dyskinesia, drooling, and dysarthria. The severity of the hyperkinesis is variable. {ECO:0000269|PubMed:27058446}. The disease is caused by variants affecting the gene represented in this entry.; DISEASE: Striatal degeneration, autosomal dominant 2 (ADSD2) [MIM:616922]: An autosomal dominant disorder characterized by striatal degeneration and dysfunction of basal ganglia, resulting in hyperkinesis. {ECO:0000269|PubMed:27058447}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB00143; DB04700 Interacts with O95273; Q8IZU0; Q60994; Q7Z3Y8 EC number 2.5.1.18 Uniprot keywords 3D-structure; Acetylation; Alternative splicing; Peroxisome; Proteomics identification; Reference proteome; Transferase Protein physicochemical properties Chain ID A,B,C,D,E,F Molecular weight (Da) 24811.7 Length 220 Aromaticity 0.08 Instability index 47.17 Isoelectric point 7.96 Charge (pH=7) 1.39 3D Binding mode Sequence GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA Hydrogen bonds contact Hydrophobic contact | ||||
| 59 | 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit | 1WVF | 8.30 | |
Target general information Gen name pchF Organism Pseudomonas putida (Arthrobacter siderocapsulatus) Uniprot ID TTD ID NA Synonyms NA Protein family NA Biochemical class Oxidoreductase Function 4-cresol dehydrogenase (hydroxylating) activity.Flavin adenine dinucleotide binding.Oxidoreductase activity, acting on CH-OH group of donors. Related diseases Dihydrolipoamide dehydrogenase deficiency (DLDD) [MIM:246900]: An autosomal recessive metabolic disorder characterized biochemically by a combined deficiency of the branched-chain alpha-keto acid dehydrogenase complex (BCKDC), pyruvate dehydrogenase complex (PDC), and alpha-ketoglutarate dehydrogenase complex (KGDC). Clinically, affected individuals have lactic acidosis and neurologic deterioration due to sensitivity of the central nervous system to defects in oxidative metabolism. {ECO:0000269|PubMed:10448086, ECO:0000269|PubMed:11687750, ECO:0000269|PubMed:12925875, ECO:0000269|PubMed:15712224, ECO:0000269|PubMed:16442803, ECO:0000269|PubMed:16770810, ECO:0000269|PubMed:17404228, ECO:0000269|PubMed:20160912, ECO:0000269|PubMed:8506365, ECO:0000269|PubMed:8968745, ECO:0000269|PubMed:9540846, ECO:0000269|PubMed:9934985}. The disease is caused by variants affecting the gene represented in this entry. Drugs (DrugBank ID) DB03147 Interacts with NA EC number 1.17.9.1 Uniprot keywords 3D-structure; Direct protein sequencing; FAD; Flavoprotein; Oxidoreductase; Plasmid Protein physicochemical properties Chain ID A Molecular weight (Da) 57240.8 Length 515 Aromaticity 0.1 Instability index 30.94 Isoelectric point 6.06 Charge (pH=7) -4.42 3D Binding mode Sequence AVLPKGVTQGEFNKAVQKFRALLGDDNVLVESDQLVPYNKIMMPVENAAHAPSAAVTATTVEQVQGVVKICNEHKIPIWTISTGRNFGYGSAAPVQRGQVILDLKKMNKIIKIDPEMCYALVEPGVTFGQMYDYIQENNLPVMLSFSAPSAIAGPVGNTMDRGVGYTPYGEHFMMQCGMEVVLANGDVYRTGMGGVPGSNTWQIFKWGYGPTLDGMFTQANYGICTKMGFWLMPKPPVFKPFEVIFEDEADIVEIVDALRPLRMSNTIPNSVVIASTLWEAGSAHLTRAQYTTEPGHTPDSVIKQMQKDTGMGAWNLYAALYGTQEQVDVNWKIVTDVFKKLGKGRIVTQEEAGDTQPFKYRAQLMSGVPNLQEFGLYNWRGGGGSMWFAPVSEARGSECKKQAAMAKRVLHKYGLDYVAEFIVAPRDMHHVIDVLYDRTNPEETKRADACFNELLDEFEKEGYAVYRVNTRFQDRVAQSYGPVKRKLEHAIKRAVDPNNILAPGRSGIDLNNDF Hydrogen bonds contact Hydrophobic contact | ||||
| 60 | Cytochrome P450 2C8 | 2NNJ | 8.30 | |
Target general information Gen name CYP2C8 Organism Homo sapiens (Human) Uniprot ID TTD ID NA Synonyms NA Protein family Cytochrome P450 family Biochemical class Oxidoreductase Function Arachidonic acid epoxygenase activity.Aromatase activity.Caffeine oxidase activity.Estrogen 16-alpha-hydroxylase activity.Heme binding.Iron ion binding.Monooxygenase activity.Oxygen binding. Related diseases A chromosomal aberration involving BCL2 has been found in chronic lymphatic leukemia. Translocation t(14;18)(q32;q21) with immunoglobulin gene regions. BCL2 mutations found in non-Hodgkin lymphomas carrying the chromosomal translocation could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions. {ECO:0000269|PubMed:2875799, ECO:0000269|PubMed:3285301}. Drugs (DrugBank ID) DB08607; DB08496; DB14055; DB12001; DB05812; DB15568; DB00918; DB12015; DB01424; DB01118; DB00321; DB00381; DB00613; DB01060; DB17449; DB01217; DB01435; DB11901; DB06605; DB00714; DB01072; DB01076; DB11995; DB00972; DB08822; DB12781; DB13997; DB05015; DB16703; DB06770; DB05229; DB00443; DB12236; DB00307; DB01393; DB13746; DB16536; DB06616; DB12267; DB12151; DB01194; DB01222; DB00921; DB06772; DB08875; DB00201; DB13919; DB00796; DB09061; DB08502; DB00564; DB00482; DB06119; DB00439; DB00608; DB00169; DB09201; DB00501; DB00604; DB12499; DB00349; DB00845; DB00758; DB00257; DB00363; DB00907; DB01394; DB05219; DB00531; DB08912; DB11682; DB00250; DB09183; DB01609; DB01234; DB14649; DB09213; DB00829; DB00586; DB00255; DB00343; DB01184; DB00625; DB11979; DB15444; DB06210; DB13874; DB11718; DB08899; DB00530; DB00783; DB13952; DB13953; DB13954; DB13955; DB13956; DB00402; DB00977; DB14766; DB00973; DB12466; DB04854; DB01023; DB01039; DB16165; DB00544; DB13867; DB08906; DB00588; DB01095; DB11679; DB01241; DB01645; DB11978; DB01218; DB00741; DB14538; DB14539; DB14540; DB14541; DB14542; DB14543; DB14545; DB14544; DB01611; DB12471; DB01050; DB09054; DB01181; DB00619; DB16200; DB01029; DB11633; DB06636; DB00951; DB11757; DB14568; DB09570; DB01221; DB06738; DB01026; DB01009; DB00465; DB00448; DB01259; DB09078; DB12070; DB05667; DB08918; DB00451; DB04725; DB00281; DB17083; DB01583; DB09198; DB06448; DB00836; DB00455; DB12130; DB00678; DB00227; DB09280; DB15935; DB06077; DB08932; DB14921; DB14009; DB00603; DB00784; DB00814; DB00170; DB00532; DB01357; DB00333; DB09241; DB00959; DB00916; DB01110; DB06595; DB00834; DB16236; DB11763; DB00764; DB14512; DB00471; DB00295; DB06510; DB00688; DB01024; DB00486; DB00788; DB09199; DB00622; DB00184; DB01115; DB04868; DB06712; DB12005; DB06670; DB09080; DB16267; DB12513; DB09296; DB00338; DB11632; DB01062; DB12612; DB01229; DB03796; DB05467; DB00617; DB06589; DB08922; DB00850; DB00780; DB01174; DB00946; DB00252; DB01132; DB00554; DB17472; DB08860; DB08901; DB15822; DB14631; DB00635; DB01032; DB00818; DB00205; DB04216; DB00908; DB00468; DB01129; DB00481; DB08896; DB11853; DB14761; DB00912; DB16826; DB00615; DB01045; DB11753; DB01201; DB01220; DB08864; DB08931; DB14840; DB14924; DB00503; DB09200; DB00533; DB00412; DB04847; DB12332; DB00938; DB12543; DB01232; DB00418; DB01037; DB11362; DB15685; DB11689; DB06739; DB00641; DB01261; DB00398; DB15569; DB00421; DB09118; DB00359; DB06729; DB01138; DB00675; DB00799; DB12020; DB09256; DB01079; DB12095; DB15133; DB00857; DB00342; DB08880; DB00624; DB13943; DB13944; DB13946; DB11712; DB00208; DB06137; DB01124; DB01685; DB00214; DB08911; DB00374; DB00755; DB00897; DB12245; DB12808; DB00347; DB00440; DB00197; DB13179; DB11652; DB15328; DB12255; DB15114; DB00862; DB11613; DB08881; DB00661; DB08828; DB09068; DB12026; DB00682; DB00549; DB01198 Interacts with P13473-2; O75400-2; Q9Y371 EC number 1.14.14.1 Uniprot keywords 3D-structure; Alternative splicing; Direct protein sequencing; Endoplasmic reticulum; Heme; Iron; Lipid metabolism; Membrane; Metal-binding; Microsome; Monooxygenase; Oxidoreductase; Phosphoprotein; Proteomics identification; Reference proteome; Steroid metabolism Protein physicochemical properties Chain ID A Molecular weight (Da) 52511 Length 463 Aromaticity 0.1 Instability index 37.03 Isoelectric point 8.6 Charge (pH=7) 6.74 3D Binding mode Sequence KLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV Hydrogen bonds contact Hydrophobic contact | ||||